BLASTX nr result
ID: Forsythia21_contig00049013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049013 (239 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003013734.1| hypothetical protein ARB_00185 [Arthroderma ... 70 6e-10 gb|EGE03054.1| hypothetical protein TEQG_02091 [Trichophyton equ... 70 6e-10 gb|EGD93829.1| hypothetical protein TESG_01361 [Trichophyton ton... 70 6e-10 ref|XP_003231946.1| hypothetical protein TERG_07565 [Trichophyto... 70 6e-10 ref|XP_003177637.1| hypothetical protein MGYG_01705 [Microsporum... 70 6e-10 ref|XP_002851047.1| conserved hypothetical protein [Arthroderma ... 70 6e-10 gb|KMU88632.1| hypothetical protein CIHG_06571 [Coccidioides imm... 70 7e-10 ref|XP_003068319.1| hypothetical protein CPC735_003430 [Coccidio... 70 7e-10 ref|XP_001244606.1| hypothetical protein CIMG_04047 [Coccidioide... 70 7e-10 ref|XP_002542406.1| conserved hypothetical protein [Uncinocarpus... 68 3e-09 gb|EME38541.1| hypothetical protein DOTSEDRAFT_67284 [Dothistrom... 65 1e-08 ref|XP_010760270.1| hypothetical protein PADG_04475 [Paracoccidi... 64 3e-08 gb|EEH08850.1| conserved hypothetical protein [Histoplasma capsu... 64 3e-08 gb|EQL32250.1| hypothetical protein BDFG_05606 [Blastomyces derm... 64 3e-08 ref|XP_002627911.1| conserved hypothetical protein [Blastomyces ... 64 3e-08 ref|XP_001540085.1| predicted protein [Histoplasma capsulatum NA... 64 3e-08 gb|KKZ64654.1| hypothetical protein EMCG_09436 [Emmonsia crescen... 64 5e-08 ref|XP_007758479.1| hypothetical protein A1O7_06286 [Cladophialo... 64 5e-08 ref|XP_008728790.1| hypothetical protein G647_06246 [Cladophialo... 63 7e-08 ref|XP_007588978.1| hypothetical protein UCRNP2_9747 [Neofusicoc... 63 7e-08 >ref|XP_003013734.1| hypothetical protein ARB_00185 [Arthroderma benhamiae CBS 112371] gi|302664270|ref|XP_003023768.1| hypothetical protein TRV_02093 [Trichophyton verrucosum HKI 0517] gi|291177299|gb|EFE33094.1| hypothetical protein ARB_00185 [Arthroderma benhamiae CBS 112371] gi|291187780|gb|EFE43150.1| hypothetical protein TRV_02093 [Trichophyton verrucosum HKI 0517] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 88 GEYFDRNDLPARFRRAPWSQAEIDAIETGGASMFA 122 >gb|EGE03054.1| hypothetical protein TEQG_02091 [Trichophyton equinum CBS 127.97] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 88 GEYFDRNDLPARFRRVPWSQAEIDAIETGGASMFA 122 >gb|EGD93829.1| hypothetical protein TESG_01361 [Trichophyton tonsurans CBS 112818] gi|607892668|gb|EZF31997.1| hypothetical protein H101_04411 [Trichophyton interdigitale H6] gi|633043584|gb|KDB20895.1| hypothetical protein H109_07160 [Trichophyton interdigitale MR816] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 88 GEYFDRNDLPARFRRAPWSQAEIDAIETGGASMFA 122 >ref|XP_003231946.1| hypothetical protein TERG_07565 [Trichophyton rubrum CBS 118892] gi|326465891|gb|EGD91344.1| hypothetical protein TERG_07565 [Trichophyton rubrum CBS 118892] gi|607882027|gb|EZF26759.1| hypothetical protein H100_01145 [Trichophyton rubrum MR850] gi|607908843|gb|EZF45847.1| hypothetical protein H102_01142 [Trichophyton rubrum CBS 100081] gi|607920849|gb|EZF56440.1| hypothetical protein H103_01149 [Trichophyton rubrum CBS 288.86] gi|607932965|gb|EZF67118.1| hypothetical protein H104_01135 [Trichophyton rubrum CBS 289.86] gi|607944798|gb|EZF77667.1| hypothetical protein H105_01155 [Trichophyton soudanense CBS 452.61] gi|607956941|gb|EZF88361.1| hypothetical protein H110_01152 [Trichophyton rubrum MR1448] gi|607969013|gb|EZF99032.1| hypothetical protein H113_01152 [Trichophyton rubrum MR1459] gi|607981209|gb|EZG10124.1| hypothetical protein H106_00948 [Trichophyton rubrum CBS 735.88] gi|607993161|gb|EZG20705.1| hypothetical protein H107_01201 [Trichophyton rubrum CBS 202.88] gi|633063144|gb|KDB37416.1| hypothetical protein H112_01152 [Trichophyton rubrum D6] gi|861300819|gb|KMQ45042.1| Ribosomal protein S36, mitochondrial [Trichophyton rubrum] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 88 GEYFDRNDLPARFRRAPWSQAEIDAIETGGASMFA 122 >ref|XP_003177637.1| hypothetical protein MGYG_01705 [Microsporum gypseum CBS 118893] gi|311339483|gb|EFQ98685.1| hypothetical protein MGYG_01705 [Microsporum gypseum CBS 118893] Length = 127 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 93 GEYFDRNDLPARFRRAPWSQAEIDAIETGGASMFA 127 >ref|XP_002851047.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238838601|gb|EEQ28263.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PWSQAEIDAIE+GGAS+FA Sbjct: 88 GEYFDRNDLPARFRRAPWSQAEIDAIETGGASMFA 122 >gb|KMU88632.1| hypothetical protein CIHG_06571 [Coccidioides immitis H538.4] Length = 83 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP+RFRR PWSQAEI+AIE+GGASLFA Sbjct: 49 GEYFDRNDLPERFRRIPWSQAEIEAIETGGASLFA 83 >ref|XP_003068319.1| hypothetical protein CPC735_003430 [Coccidioides posadasii C735 delta SOWgp] gi|240108000|gb|EER26174.1| hypothetical protein CPC735_003430 [Coccidioides posadasii C735 delta SOWgp] gi|320038115|gb|EFW20051.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|855539294|gb|KMM73382.1| hypothetical protein CPAG_09671 [Coccidioides posadasii RMSCC 3488] Length = 125 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP+RFRR PWSQAEI+AIE+GGASLFA Sbjct: 91 GEYFDRNDLPERFRRIPWSQAEIEAIETGGASLFA 125 >ref|XP_001244606.1| hypothetical protein CIMG_04047 [Coccidioides immitis RS] gi|767022913|gb|EAS33023.3| hypothetical protein CIMG_04047 [Coccidioides immitis RS] gi|859414712|gb|KMP08304.1| hypothetical protein CIRG_07985 [Coccidioides immitis RMSCC 2394] gi|875278493|gb|KMU72437.1| hypothetical protein CISG_03085 [Coccidioides immitis RMSCC 3703] Length = 125 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP+RFRR PWSQAEI+AIE+GGASLFA Sbjct: 91 GEYFDRNDLPERFRRIPWSQAEIEAIETGGASLFA 125 >ref|XP_002542406.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237902672|gb|EEP77073.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 124 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRNDLP RFRR PW+QAEI+A+E+GGASLFA Sbjct: 90 GEYFDRNDLPARFRRVPWTQAEIEAVETGGASLFA 124 >gb|EME38541.1| hypothetical protein DOTSEDRAFT_67284 [Dothistroma septosporum NZE10] Length = 145 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GE DRNDLP+RF+R PWSQAEIDAIESGGAS+FA Sbjct: 111 GEVLDRNDLPRRFQRVPWSQAEIDAIESGGASMFA 145 >ref|XP_010760270.1| hypothetical protein PADG_04475 [Paracoccidioides brasiliensis Pb18] gi|225683631|gb|EEH21915.1| hypothetical protein PABG_04126 [Paracoccidioides brasiliensis Pb03] gi|226292976|gb|EEH48396.1| hypothetical protein PADG_04475 [Paracoccidioides brasiliensis Pb18] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGASLFA Sbjct: 92 GEYFDRNELPERFRRMTWSQEEIDAVETGGASLFA 126 >gb|EEH08850.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] gi|240280132|gb|EER43636.1| conserved hypothetical protein [Histoplasma capsulatum H143] gi|325088853|gb|EGC42163.1| conserved hypothetical protein [Histoplasma capsulatum H88] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGASLFA Sbjct: 92 GEYFDRNELPERFRRLTWSQEEIDAVETGGASLFA 126 >gb|EQL32250.1| hypothetical protein BDFG_05606 [Blastomyces dermatitidis ATCC 26199] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGASLFA Sbjct: 92 GEYFDRNELPERFRRLTWSQEEIDAVETGGASLFA 126 >ref|XP_002627911.1| conserved hypothetical protein [Blastomyces dermatitidis SLH14081] gi|239592970|gb|EEQ75551.1| conserved hypothetical protein [Blastomyces dermatitidis SLH14081] gi|239610851|gb|EEQ87838.1| conserved hypothetical protein [Blastomyces dermatitidis ER-3] gi|327350379|gb|EGE79236.1| hypothetical protein BDDG_02174 [Blastomyces dermatitidis ATCC 18188] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGASLFA Sbjct: 92 GEYFDRNELPERFRRLTWSQEEIDAVETGGASLFA 126 >ref|XP_001540085.1| predicted protein [Histoplasma capsulatum NAm1] gi|150413670|gb|EDN09053.1| predicted protein [Histoplasma capsulatum NAm1] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGASLFA Sbjct: 92 GEYFDRNELPERFRRLTWSQEEIDAVETGGASLFA 126 >gb|KKZ64654.1| hypothetical protein EMCG_09436 [Emmonsia crescens UAMH 3008] Length = 126 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GEYFDRN+LP+RFRR WSQ EIDA+E+GGAS+FA Sbjct: 92 GEYFDRNELPERFRRLTWSQEEIDAVETGGASMFA 126 >ref|XP_007758479.1| hypothetical protein A1O7_06286 [Cladophialophora yegresii CBS 114405] gi|589975555|gb|EXJ58856.1| hypothetical protein A1O7_06286 [Cladophialophora yegresii CBS 114405] Length = 139 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GE+FDR++LPKRFRRTPWS+ EI+AI SGGAS+FA Sbjct: 105 GEFFDRDELPKRFRRTPWSEEEIEAITSGGASMFA 139 >ref|XP_008728790.1| hypothetical protein G647_06246 [Cladophialophora carrionii CBS 160.54] gi|565932907|gb|ETI22173.1| hypothetical protein G647_06246 [Cladophialophora carrionii CBS 160.54] Length = 139 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLFA 135 GE+FDR++LPKRFRRTPWS+ EI+A+ SGGAS+FA Sbjct: 105 GEFFDRDELPKRFRRTPWSEEEIEAVTSGGASMFA 139 >ref|XP_007588978.1| hypothetical protein UCRNP2_9747 [Neofusicoccum parvum UCRNP2] gi|485916148|gb|EOD43547.1| hypothetical protein UCRNP2_9747 [Neofusicoccum parvum UCRNP2] Length = 120 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 239 GEYFDRNDLPKRFRRTPWSQAEIDAIESGGASLF 138 GE FDRN+LP RFRR PWSQ+EI+AIESGGASLF Sbjct: 86 GEVFDRNELPSRFRRLPWSQSEIEAIESGGASLF 119