BLASTX nr result
ID: Forsythia21_contig00048084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00048084 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008028555.1| hypothetical protein SETTUDRAFT_139052 [Seto... 91 3e-16 ref|XP_001941308.1| conserved hypothetical protein [Pyrenophora ... 89 1e-15 ref|XP_003306078.1| hypothetical protein PTT_19105 [Pyrenophora ... 87 3e-15 ref|XP_007686740.1| hypothetical protein COCMIDRAFT_46972, parti... 87 4e-15 ref|XP_007708801.1| hypothetical protein COCCADRAFT_86941 [Bipol... 87 4e-15 gb|EMD92362.1| hypothetical protein COCHEDRAFT_1079543, partial ... 87 4e-15 ref|XP_007696659.1| hypothetical protein COCSADRAFT_44268, parti... 87 4e-15 ref|XP_001801229.1| hypothetical protein SNOG_10973 [Phaeosphaer... 80 4e-13 ref|XP_003845055.1| predicted protein [Leptosphaeria maculans JN... 80 5e-13 ref|XP_007778305.1| hypothetical protein W97_02214 [Coniosporium... 62 1e-07 gb|EKG18970.1| hypothetical protein MPH_03787 [Macrophomina phas... 59 1e-06 gb|KKY22212.1| hypothetical protein UCDDS831_g03770 [Diplodia se... 56 8e-06 >ref|XP_008028555.1| hypothetical protein SETTUDRAFT_139052 [Setosphaeria turcica Et28A] gi|482807134|gb|EOA84186.1| hypothetical protein SETTUDRAFT_139052 [Setosphaeria turcica Et28A] Length = 79 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 ESRQQVYVS GFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH Sbjct: 6 ESRQQVYVS-QGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 50 >ref|XP_001941308.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977401|gb|EDU44027.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 80 Score = 88.6 bits (218), Expect = 1e-15 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 ESRQQVYVS DGFSEPMSAQHNFAN+FDLNDP+RAMS+YQRIMHEH Sbjct: 6 ESRQQVYVS-DGFSEPMSAQHNFANHFDLNDPDRAMSEYQRIMHEH 50 >ref|XP_003306078.1| hypothetical protein PTT_19105 [Pyrenophora teres f. teres 0-1] gi|311316603|gb|EFQ85824.1| hypothetical protein PTT_19105 [Pyrenophora teres f. teres 0-1] Length = 80 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 ESRQQVYVS DGFSEPMSAQHNFAN+FDLNDP+RAM++YQRIMHEH Sbjct: 6 ESRQQVYVS-DGFSEPMSAQHNFANHFDLNDPDRAMTEYQRIMHEH 50 >ref|XP_007686740.1| hypothetical protein COCMIDRAFT_46972, partial [Bipolaris oryzae ATCC 44560] gi|576933267|gb|EUC46796.1| hypothetical protein COCMIDRAFT_46972, partial [Bipolaris oryzae ATCC 44560] Length = 74 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 E+RQ VYVS +GFSEPMSAQHNFANNFDLNDPERAMS+YQRIMHEH Sbjct: 6 ETRQSVYVS-EGFSEPMSAQHNFANNFDLNDPERAMSEYQRIMHEH 50 >ref|XP_007708801.1| hypothetical protein COCCADRAFT_86941 [Bipolaris zeicola 26-R-13] gi|576922861|gb|EUC36985.1| hypothetical protein COCCADRAFT_86941 [Bipolaris zeicola 26-R-13] gi|578492799|gb|EUN30196.1| hypothetical protein COCVIDRAFT_35071 [Bipolaris victoriae FI3] Length = 78 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 E+RQ VYVS DGFSEPM AQHNFANNFDLNDPERAMS+YQRIMHEH Sbjct: 6 ETRQSVYVS-DGFSEPMGAQHNFANNFDLNDPERAMSEYQRIMHEH 50 >gb|EMD92362.1| hypothetical protein COCHEDRAFT_1079543, partial [Bipolaris maydis C5] gi|477590980|gb|ENI08053.1| hypothetical protein COCC4DRAFT_114346, partial [Bipolaris maydis ATCC 48331] Length = 74 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 E+RQ VYVS +GFSEPMSAQHNFANNFDLNDPERAMS+YQRIMHEH Sbjct: 6 ETRQSVYVS-EGFSEPMSAQHNFANNFDLNDPERAMSEYQRIMHEH 50 >ref|XP_007696659.1| hypothetical protein COCSADRAFT_44268, partial [Bipolaris sorokiniana ND90Pr] gi|451853981|gb|EMD67274.1| hypothetical protein COCSADRAFT_44268, partial [Bipolaris sorokiniana ND90Pr] Length = 74 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 E+RQ VYVS DGFSEPMS QHNFANNFDLNDPERAMS+YQRIMHEH Sbjct: 6 ETRQSVYVS-DGFSEPMSTQHNFANNFDLNDPERAMSEYQRIMHEH 50 >ref|XP_001801229.1| hypothetical protein SNOG_10973 [Phaeosphaeria nodorum SN15] gi|111060352|gb|EAT81472.1| hypothetical protein SNOG_10973 [Phaeosphaeria nodorum SN15] Length = 85 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 138 ESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 ++RQQVYVS DGFSEPMSAQHNFANNFDL++P+ AMS YQRIMHEH Sbjct: 6 QNRQQVYVS-DGFSEPMSAQHNFANNFDLDNPDAAMSAYQRIMHEH 50 >ref|XP_003845055.1| predicted protein [Leptosphaeria maculans JN3] gi|312221636|emb|CBY01576.1| predicted protein [Leptosphaeria maculans JN3] Length = 173 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/64 (64%), Positives = 44/64 (68%) Frame = -3 Query: 192 LYFXXXXXXXXXXXXXXTESRQQVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRI 13 LYF + RQQVYVS D FSEPMSAQHNFANNFDLNDPE AM+ YQ+I Sbjct: 81 LYFNYIPSPPPSNMSAMNDVRQQVYVSDD-FSEPMSAQHNFANNFDLNDPESAMTAYQKI 139 Query: 12 MHEH 1 MHEH Sbjct: 140 MHEH 143 >ref|XP_007778305.1| hypothetical protein W97_02214 [Coniosporium apollinis CBS 100218] gi|494825858|gb|EON62988.1| hypothetical protein W97_02214 [Coniosporium apollinis CBS 100218] Length = 85 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 123 VYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 VY+ G GFSEPMSAQHNF+N + +DP+ AMS Y+RIMH+H Sbjct: 9 VYIHG-GFSEPMSAQHNFSNQYSFDDPQEAMSVYKRIMHQH 48 >gb|EKG18970.1| hypothetical protein MPH_03787 [Macrophomina phaseolina MS6] Length = 85 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 123 VYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 VYV D FS PMSAQHNFAN +DL++P ++MS Y R+MHEH Sbjct: 8 VYVR-DNFSAPMSAQHNFANQYDLDNPTQSMSIYSRVMHEH 47 >gb|KKY22212.1| hypothetical protein UCDDS831_g03770 [Diplodia seriata] Length = 85 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -3 Query: 126 QVYVSGDGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEH 1 +VYV+ D +S PMS QHNFAN++DL++P +MS Y R+MHEH Sbjct: 7 RVYVTDD-YSAPMSPQHNFANSYDLDNPTASMSIYARVMHEH 47