BLASTX nr result
ID: Forsythia21_contig00047293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047293 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006292114.1| hypothetical protein CARUB_v10018310mg, part... 73 6e-11 ref|XP_012066482.1| PREDICTED: uncharacterized protein LOC105629... 73 8e-11 ref|XP_010101586.1| hypothetical protein L484_015415 [Morus nota... 72 1e-10 ref|XP_008241253.1| PREDICTED: uncharacterized protein LOC103339... 72 1e-10 gb|KDP42732.1| hypothetical protein JCGZ_23672 [Jatropha curcas] 72 1e-10 ref|XP_002528726.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 ref|XP_002308149.1| hypothetical protein POPTR_0006s08320g [Popu... 72 1e-10 ref|XP_006481795.1| PREDICTED: uncharacterized protein LOC102630... 72 1e-10 ref|XP_007145318.1| hypothetical protein PHAVU_007G229000g [Phas... 72 1e-10 ref|XP_006430233.1| hypothetical protein CICLE_v10013416mg [Citr... 72 1e-10 gb|EPS57691.1| hypothetical protein M569_17126 [Genlisea aurea] 72 1e-10 ref|XP_004516197.1| PREDICTED: uncharacterized protein LOC101514... 72 1e-10 ref|XP_007204541.1| hypothetical protein PRUPE_ppa017106mg [Prun... 72 1e-10 ref|XP_006594210.1| PREDICTED: uncharacterized protein LOC100789... 72 1e-10 gb|ACU16874.1| unknown [Glycine max] gi|734353828|gb|KHN13505.1|... 72 1e-10 ref|XP_011094366.1| PREDICTED: uncharacterized protein LOC105174... 72 1e-10 ref|XP_012839681.1| PREDICTED: uncharacterized protein LOC105960... 72 1e-10 emb|CDX73606.1| BnaC08g23970D [Brassica napus] 72 2e-10 ref|XP_009115973.1| PREDICTED: uncharacterized protein LOC103841... 72 2e-10 emb|CDX95371.1| BnaC04g27870D [Brassica napus] 72 2e-10 >ref|XP_006292114.1| hypothetical protein CARUB_v10018310mg, partial [Capsella rubella] gi|482560821|gb|EOA25012.1| hypothetical protein CARUB_v10018310mg, partial [Capsella rubella] Length = 95 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 317 KEMERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 K MERLNSKLY+ENCYIMKENERLRKKAELLNQENQ L Sbjct: 26 KTMERLNSKLYVENCYIMKENERLRKKAELLNQENQQL 63 >ref|XP_012066482.1| PREDICTED: uncharacterized protein LOC105629484 [Jatropha curcas] Length = 118 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 326 NLPKEMERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 NL MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 37 NLFIVMERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 77 >ref|XP_010101586.1| hypothetical protein L484_015415 [Morus notabilis] gi|587900410|gb|EXB88725.1| hypothetical protein L484_015415 [Morus notabilis] Length = 81 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_008241253.1| PREDICTED: uncharacterized protein LOC103339698 [Prunus mume] gi|645272145|ref|XP_008241254.1| PREDICTED: uncharacterized protein LOC103339698 [Prunus mume] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >gb|KDP42732.1| hypothetical protein JCGZ_23672 [Jatropha curcas] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_002528726.1| conserved hypothetical protein [Ricinus communis] gi|223531820|gb|EEF33638.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_002308149.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa] gi|222854125|gb|EEE91672.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_006481795.1| PREDICTED: uncharacterized protein LOC102630060 [Citrus sinensis] Length = 76 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_007145318.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|593689400|ref|XP_007145319.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|593689402|ref|XP_007145320.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018508|gb|ESW17312.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018509|gb|ESW17313.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018510|gb|ESW17314.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] Length = 75 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_006430233.1| hypothetical protein CICLE_v10013416mg [Citrus clementina] gi|557532290|gb|ESR43473.1| hypothetical protein CICLE_v10013416mg [Citrus clementina] gi|641842210|gb|KDO61118.1| hypothetical protein CISIN_1g047813mg [Citrus sinensis] Length = 74 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >gb|EPS57691.1| hypothetical protein M569_17126 [Genlisea aurea] Length = 100 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 314 EMERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 +ME+LNSKLYLENCYIM+ENERLRKKAELLNQENQAL Sbjct: 34 KMEKLNSKLYLENCYIMQENERLRKKAELLNQENQAL 70 >ref|XP_004516197.1| PREDICTED: uncharacterized protein LOC101514572 [Cicer arietinum] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_007204541.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica] gi|462400072|gb|EMJ05740.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_006594210.1| PREDICTED: uncharacterized protein LOC100789735 isoform X1 [Glycine max] gi|571498413|ref|XP_006594211.1| PREDICTED: uncharacterized protein LOC100789735 isoform X2 [Glycine max] gi|571498415|ref|XP_006594212.1| PREDICTED: uncharacterized protein LOC100789735 isoform X3 [Glycine max] gi|571498417|ref|XP_006594213.1| PREDICTED: uncharacterized protein LOC100789735 isoform X4 [Glycine max] gi|734358699|gb|KHN14992.1| hypothetical protein glysoja_037119 [Glycine soja] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >gb|ACU16874.1| unknown [Glycine max] gi|734353828|gb|KHN13505.1| hypothetical protein glysoja_038743 [Glycine soja] Length = 78 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLYL+NCYIMKENERLRKKA+LLNQENQAL Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQAL 36 >ref|XP_011094366.1| PREDICTED: uncharacterized protein LOC105174081 [Sesamum indicum] Length = 66 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 ME+LNSKLYLENCYIM+ENERLRKKAELLNQENQAL Sbjct: 1 MEKLNSKLYLENCYIMQENERLRKKAELLNQENQAL 36 >ref|XP_012839681.1| PREDICTED: uncharacterized protein LOC105960057 [Erythranthe guttatus] gi|604330446|gb|EYU35474.1| hypothetical protein MIMGU_mgv1a017448mg [Erythranthe guttata] Length = 74 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 ME+LNSKLYLENCYIM+ENERLRKKAELLNQENQAL Sbjct: 1 MEKLNSKLYLENCYIMQENERLRKKAELLNQENQAL 36 >emb|CDX73606.1| BnaC08g23970D [Brassica napus] Length = 69 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLY+ENCYIMKENERLRKKAELLNQENQ L Sbjct: 1 MERLNSKLYVENCYIMKENERLRKKAELLNQENQQL 36 >ref|XP_009115973.1| PREDICTED: uncharacterized protein LOC103841207 [Brassica rapa] gi|685363424|ref|XP_009115974.1| PREDICTED: uncharacterized protein LOC103841207 [Brassica rapa] gi|674955395|emb|CDX78123.1| BnaA09g33180D [Brassica napus] Length = 69 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLY+ENCYIMKENERLRKKAELLNQENQ L Sbjct: 1 MERLNSKLYVENCYIMKENERLRKKAELLNQENQQL 36 >emb|CDX95371.1| BnaC04g27870D [Brassica napus] Length = 70 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 311 MERLNSKLYLENCYIMKENERLRKKAELLNQENQAL 204 MERLNSKLY+ENCYIMKENERLRKKAELLNQENQ L Sbjct: 1 MERLNSKLYVENCYIMKENERLRKKAELLNQENQQL 36