BLASTX nr result
ID: Forsythia21_contig00046885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046885 (303 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847776.1| PREDICTED: ras GTPase-activating protein-bin... 68 3e-09 ref|XP_011101762.1| PREDICTED: ras GTPase-activating protein-bin... 67 6e-09 >ref|XP_012847776.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Erythranthe guttatus] Length = 400 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 303 VEFESSDAAHRAVEAHHVTFGDKEAYITYKRSSNRGGN 190 VEFES+D+A RAVEAHH+ FGDKEAYITYKRSS RG N Sbjct: 306 VEFESADSARRAVEAHHIKFGDKEAYITYKRSSARGNN 343 >ref|XP_011101762.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Sesamum indicum] Length = 488 Score = 66.6 bits (161), Expect = 6e-09 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -1 Query: 303 VEFESSDAAHRAVEAHHVTFGDKEAYITYKRS-SNRGGNREGPS 175 VEFES+D+A RAVE HHV FGDKEAYITYKRS SNRG N G S Sbjct: 387 VEFESADSARRAVEVHHVKFGDKEAYITYKRSYSNRGNNGGGRS 430