BLASTX nr result
ID: Forsythia21_contig00046763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046763 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071268.1| PREDICTED: putative pentatricopeptide repeat... 114 3e-23 ref|XP_012855327.1| PREDICTED: putative pentatricopeptide repeat... 109 8e-22 ref|XP_012478811.1| PREDICTED: putative pentatricopeptide repeat... 100 4e-19 ref|XP_011009314.1| PREDICTED: putative pentatricopeptide repeat... 100 6e-19 emb|CBI27406.3| unnamed protein product [Vitis vinifera] 98 2e-18 ref|XP_002267299.2| PREDICTED: LOW QUALITY PROTEIN: putative pen... 98 2e-18 ref|XP_010243620.1| PREDICTED: putative pentatricopeptide repeat... 97 4e-18 ref|XP_009355583.1| PREDICTED: putative pentatricopeptide repeat... 96 9e-18 emb|CDP00488.1| unnamed protein product [Coffea canephora] 96 9e-18 ref|XP_012067072.1| PREDICTED: putative pentatricopeptide repeat... 94 3e-17 ref|XP_009595136.1| PREDICTED: putative pentatricopeptide repeat... 94 3e-17 ref|XP_006484267.1| PREDICTED: putative pentatricopeptide repeat... 94 5e-17 ref|XP_009782067.1| PREDICTED: putative pentatricopeptide repeat... 92 1e-16 ref|XP_008339747.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_008339746.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_002514579.1| pentatricopeptide repeat-containing protein,... 92 2e-16 ref|XP_008465042.1| PREDICTED: putative pentatricopeptide repeat... 90 5e-16 ref|XP_008351037.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 89 1e-15 ref|XP_004297191.1| PREDICTED: putative pentatricopeptide repeat... 89 1e-15 ref|XP_009123963.1| PREDICTED: putative pentatricopeptide repeat... 88 2e-15 >ref|XP_011071268.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Sesamum indicum] Length = 781 Score = 114 bits (285), Expect = 3e-23 Identities = 54/77 (70%), Positives = 63/77 (81%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 N+ VKHSR QF+IAHILA K+R RAL+ HL +VLQ++G GSAPSLCELL +FRGWDS Sbjct: 59 NQFGVKHSRNLQFVIAHILAEKKRSRALRCHLQRVLQDEGCGSAPSLCELLYKSFRGWDS 118 Query: 181 SHMVWDMLAFVYSRNNM 231 +HMVWDMLAFVY R M Sbjct: 119 NHMVWDMLAFVYCRAGM 135 >ref|XP_012855327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Erythranthe guttatus] Length = 828 Score = 109 bits (272), Expect = 8e-22 Identities = 51/77 (66%), Positives = 62/77 (80%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 N KHSR SQF++AH LA K+R RALQ HL +VL+E+GSGSAP+LCELL +F GWDS Sbjct: 105 NVFGFKHSRNSQFVVAHCLAEKKRSRALQCHLQRVLREEGSGSAPTLCELLSKSFSGWDS 164 Query: 181 SHMVWDMLAFVYSRNNM 231 + MVWDML FVYSR++M Sbjct: 165 NKMVWDMLTFVYSRSDM 181 >ref|XP_012478811.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157866|ref|XP_012478813.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157868|ref|XP_012478814.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157870|ref|XP_012478815.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157872|ref|XP_012478816.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|763763272|gb|KJB30526.1| hypothetical protein B456_005G147900 [Gossypium raimondii] Length = 830 Score = 100 bits (249), Expect = 4e-19 Identities = 46/77 (59%), Positives = 60/77 (77%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR S+F++AH+LAG++R + L+ + Q+L+E+GSGSAPSLCELL N FR WD Sbjct: 107 NEYWFRHSRFSRFVVAHVLAGQRRHKELRFVVEQMLKEEGSGSAPSLCELLLNGFRDWDQ 166 Query: 181 SHMVWDMLAFVYSRNNM 231 +VWDMLAFVYSR M Sbjct: 167 KSLVWDMLAFVYSRFEM 183 >ref|XP_011009314.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797902|ref|XP_011009321.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797906|ref|XP_011009327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797910|ref|XP_011009335.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797914|ref|XP_011009343.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797918|ref|XP_011009349.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] Length = 832 Score = 99.8 bits (247), Expect = 6e-19 Identities = 45/77 (58%), Positives = 64/77 (83%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSRVS+F+++H+LA K+R + L+ L Q+LQE+G+GSAP LC+LL ++F+GWDS Sbjct: 109 NEFGFQHSRVSRFLVSHVLARKRRFKDLRLVLDQMLQEEGTGSAPLLCKLLFSSFKGWDS 168 Query: 181 SHMVWDMLAFVYSRNNM 231 S++VWDMLAF+YSR M Sbjct: 169 SNVVWDMLAFIYSRFEM 185 >emb|CBI27406.3| unnamed protein product [Vitis vinifera] Length = 821 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/77 (57%), Positives = 61/77 (79%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSRVS FI++H++A K + + L+ L+Q+++E+GSGSAPSLCELLCN+FR WD Sbjct: 107 NEYGFRHSRVSWFIVSHVVARKGQSKELRRVLNQMVEEEGSGSAPSLCELLCNSFRDWDL 166 Query: 181 SHMVWDMLAFVYSRNNM 231 +++VWDMLA YSR M Sbjct: 167 NNVVWDMLACAYSRAEM 183 >ref|XP_002267299.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g13630 [Vitis vinifera] Length = 829 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/77 (57%), Positives = 61/77 (79%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSRVS FI++H++A K + + L+ L+Q+++E+GSGSAPSLCELLCN+FR WD Sbjct: 107 NEYGFRHSRVSWFIVSHVVARKGQSKELRRVLNQMVEEEGSGSAPSLCELLCNSFRDWDL 166 Query: 181 SHMVWDMLAFVYSRNNM 231 +++VWDMLA YSR M Sbjct: 167 NNVVWDMLACAYSRAEM 183 >ref|XP_010243620.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nelumbo nucifera] gi|720085761|ref|XP_010243621.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nelumbo nucifera] gi|720085764|ref|XP_010243622.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nelumbo nucifera] gi|720085767|ref|XP_010243624.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nelumbo nucifera] Length = 852 Score = 97.1 bits (240), Expect = 4e-18 Identities = 44/79 (55%), Positives = 60/79 (75%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 +E +HSR+S+F+I H+LAG++R + L+ L +L+E+G GSAPSLCELL N FRGWDS Sbjct: 124 SEYNFRHSRISEFVICHVLAGQRRLKELRRLLRWMLEEEGCGSAPSLCELLSNNFRGWDS 183 Query: 181 SHMVWDMLAFVYSRNNM*N 237 + +VWD+LA YSR M N Sbjct: 184 TSLVWDVLADGYSRREMIN 202 >ref|XP_009355583.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Pyrus x bretschneideri] Length = 834 Score = 95.9 bits (237), Expect = 9e-18 Identities = 42/77 (54%), Positives = 61/77 (79%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR+S+FI+AH+LA ++ + L++ + Q++ E+G GSAPSLCEL+ + FR WDS Sbjct: 112 NECGFRHSRISEFIVAHVLATNRQFQELRSVVKQIVDEEGPGSAPSLCELILHGFRDWDS 171 Query: 181 SHMVWDMLAFVYSRNNM 231 S++VWDMLAF YSR+ M Sbjct: 172 SNVVWDMLAFAYSRSEM 188 >emb|CDP00488.1| unnamed protein product [Coffea canephora] Length = 843 Score = 95.9 bits (237), Expect = 9e-18 Identities = 49/77 (63%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE + KHSR S IAH+LA K+R RAL+ HL Q++ +GSGSAPSLCELL N FR D Sbjct: 110 NEYDFKHSRDSCISIAHVLARKERFRALKLHLLQMVHLEGSGSAPSLCELLSNGFRESDF 169 Query: 181 SHMVWDMLAFVYSRNNM 231 SH VWDMLAF YSR+ M Sbjct: 170 SHTVWDMLAFAYSRSGM 186 >ref|XP_012067072.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Jatropha curcas] gi|802563781|ref|XP_012067073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Jatropha curcas] Length = 913 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/77 (55%), Positives = 59/77 (76%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 N+ +HSRVS+ +++H+LA K+R + L+ L Q+L E+G GSAPSLCELL + F+ WDS Sbjct: 191 NQFGFRHSRVSRLVVSHLLARKRRLKELRLVLEQMLLEEGYGSAPSLCELLSSGFKSWDS 250 Query: 181 SHMVWDMLAFVYSRNNM 231 S +VWDMLAF YSR+ M Sbjct: 251 SDVVWDMLAFAYSRSEM 267 >ref|XP_009595136.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] gi|697172395|ref|XP_009595137.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] gi|697172397|ref|XP_009595138.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] gi|697172399|ref|XP_009595139.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] Length = 808 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/77 (59%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 N+ KHSRVS I+AH+LA KQR RAL+ HL ++QE+GSGSA L ELL + F+ WDS Sbjct: 109 NDYGFKHSRVSHIIVAHVLAKKQRFRALKFHLQNLVQEEGSGSASLLSELLLSRFQKWDS 168 Query: 181 SHMVWDMLAFVYSRNNM 231 +H+VWDMLA YSR M Sbjct: 169 NHVVWDMLASAYSRCQM 185 >ref|XP_006484267.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630-like [Citrus sinensis] Length = 839 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/72 (61%), Positives = 56/72 (77%) Frame = +1 Query: 16 KHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDSSHMVW 195 KHS + F+IAH+LA K+ + L+ L Q+LQE GSGSAPSLCELL ++FRG++S+ VW Sbjct: 117 KHSLFASFVIAHVLAAKRSFKGLRLVLEQILQEQGSGSAPSLCELLLHSFRGFESNREVW 176 Query: 196 DMLAFVYSRNNM 231 DMLAFVYSR M Sbjct: 177 DMLAFVYSRTGM 188 >ref|XP_009782067.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423268|ref|XP_009782072.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423274|ref|XP_009782076.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423279|ref|XP_009782082.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423287|ref|XP_009782087.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423294|ref|XP_009782097.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] gi|698423302|ref|XP_009782104.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] Length = 807 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/77 (58%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 N+ KHSRVS I+AH+LA KQR RAL+ HL ++QE+GSGSA L ELL + F+ WDS Sbjct: 108 NDYGFKHSRVSHVIVAHVLAKKQRFRALKFHLQNLVQEEGSGSASLLSELLSSRFQKWDS 167 Query: 181 SHMVWDMLAFVYSRNNM 231 +H+VWDMLA YS+ M Sbjct: 168 NHVVWDMLASAYSQCQM 184 >ref|XP_008339747.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X2 [Malus domestica] Length = 540 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/77 (54%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR+S+FI+ H+LA + + L++ + Q++ E+G GSAPSLCELL FR WDS Sbjct: 112 NECGFRHSRISEFIVVHVLATNWQFQELRSVVKQMVDEEGPGSAPSLCELLLYRFRDWDS 171 Query: 181 SHMVWDMLAFVYSRNNM 231 S +VWDMLAF YSR+ M Sbjct: 172 SSVVWDMLAFAYSRSEM 188 >ref|XP_008339746.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Malus domestica] Length = 834 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/77 (54%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR+S+FI+ H+LA + + L++ + Q++ E+G GSAPSLCELL FR WDS Sbjct: 112 NECGFRHSRISEFIVVHVLATNWQFQELRSVVKQMVDEEGPGSAPSLCELLLYRFRDWDS 171 Query: 181 SHMVWDMLAFVYSRNNM 231 S +VWDMLAF YSR+ M Sbjct: 172 SSVVWDMLAFAYSRSEM 188 >ref|XP_002514579.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546183|gb|EEF47685.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 840 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/77 (55%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR S+ +++H+LA K+R L+ L Q+L +GSGSAPSLCELL +FR WDS Sbjct: 118 NEFGFQHSRFSRLVVSHVLARKKRLNELRLVLDQMLLHEGSGSAPSLCELLLGSFRSWDS 177 Query: 181 SHMVWDMLAFVYSRNNM 231 S++VWDMLA YSR+ M Sbjct: 178 SNVVWDMLACAYSRSAM 194 >ref|XP_008465042.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130191|ref|XP_008465043.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130193|ref|XP_008465044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130195|ref|XP_008465045.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130197|ref|XP_008465046.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130199|ref|XP_008465047.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] Length = 828 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/77 (51%), Positives = 56/77 (72%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR SQF+++HILAG+ R + L + + +++E G GSA + C+LL N FR WDS Sbjct: 107 NEYGFRHSRFSQFVVSHILAGEGRFKELHSVIKHLIEEQGLGSASTFCDLLLNKFRNWDS 166 Query: 181 SHMVWDMLAFVYSRNNM 231 + +VWDMLAF YSR+ M Sbjct: 167 NGVVWDMLAFAYSRHEM 183 >ref|XP_008351037.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g13630, partial [Malus domestica] Length = 641 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/77 (50%), Positives = 57/77 (74%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +++HSR+++FI AH+LA ++ + L++ + Q++ E+G G APSLCELL FR WDS Sbjct: 118 NECDLRHSRIAEFIXAHVLAANRQFQELRSVVKQMVDEEGPGFAPSLCELLLRRFRDWDS 177 Query: 181 SHMVWDMLAFVYSRNNM 231 +VWD LAF YSR+ M Sbjct: 178 ISVVWDTLAFAYSRSEM 194 >ref|XP_004297191.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Fragaria vesca subsp. vesca] Length = 827 Score = 88.6 bits (218), Expect = 1e-15 Identities = 41/77 (53%), Positives = 56/77 (72%) Frame = +1 Query: 1 NELEVKHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDS 180 NE +HSR S F +AH+L G++R L+ + Q+++E+GSGSA SLCELL + FR W S Sbjct: 107 NEYGFRHSRASSFAVAHVLGGRRRFEELRLVMKQMVKEEGSGSATSLCELLLSRFRDWGS 166 Query: 181 SHMVWDMLAFVYSRNNM 231 S +VWD+LAF YSR+ M Sbjct: 167 SGVVWDVLAFSYSRSEM 183 >ref|XP_009123963.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X2 [Brassica rapa] Length = 798 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/72 (55%), Positives = 58/72 (80%) Frame = +1 Query: 16 KHSRVSQFIIAHILAGKQRPRALQTHLHQVLQEDGSGSAPSLCELLCNTFRGWDSSHMVW 195 +HSR+S +++HILAG++R + LQ + Q+LQE+GSGSA SLCELL +FR W+S+++VW Sbjct: 117 RHSRLSSLLVSHILAGQRRFKELQVVVEQLLQEEGSGSAFSLCELLSTSFRKWESTNVVW 176 Query: 196 DMLAFVYSRNNM 231 DML F+ SR+ M Sbjct: 177 DMLLFLSSRSKM 188