BLASTX nr result
ID: Forsythia21_contig00046516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046516 (419 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 132 7e-29 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 132 7e-29 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 130 3e-28 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 126 5e-27 ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_003607325.1| Pentatricopeptide repeat-containing protein ... 122 9e-26 ref|XP_007136983.1| hypothetical protein PHAVU_009G090400g [Phas... 119 1e-24 ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 117 4e-24 ref|NP_181456.1| pentatricopeptide repeat protein LOJ [Arabidops... 116 7e-24 ref|XP_006364273.1| PREDICTED: pentatricopeptide repeat-containi... 115 9e-24 emb|CDP04793.1| unnamed protein product [Coffea canephora] 115 1e-23 ref|XP_002515553.1| pentatricopeptide repeat-containing protein,... 115 1e-23 ref|XP_002879788.1| pentatricopeptide repeat-containing protein ... 114 3e-23 ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_010554554.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 144 bits (363), Expect = 2e-32 Identities = 70/139 (50%), Positives = 98/139 (70%) Frame = -3 Query: 417 EHWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTD 238 +H A+NLL +Y+ DS S ++V R +NCS+RFGF L PRVF+YLLN YV+ RRY D Sbjct: 131 DHHGAARNLLNNYLSGDSAPSGVVLVDRLINCSERFGFGLKPRVFDYLLNGYVKARRYKD 190 Query: 237 AIGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQ 58 A CF +VS + P + +NN LS+L+ NM+ +A+ +FR +V + +YDCATV +MM Sbjct: 191 AEDCFYLLVSRGITPHVRILNNFLSSLIRSNMIDEARGLFRDIVRKKQTYDCATVYMMMC 250 Query: 57 AFLQVGKVEEAQKYFMEAR 1 + L+ KVEEAQKYFM+A+ Sbjct: 251 SALREDKVEEAQKYFMDAK 269 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttatus] Length = 849 Score = 132 bits (333), Expect = 7e-29 Identities = 64/138 (46%), Positives = 95/138 (68%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+NLL +Y+ SDS S ++V R ++CS +FGF SPR+F+Y LN YVR +RY DA Sbjct: 122 HHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALNGYVRAQRYKDA 181 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 CF +VS ++P + +NN L +L+ +M+ +A+ +F +V + SYDCATV +MM A Sbjct: 182 EDCFYALVSRGVIPCVRILNNFLHSLIRTSMIDEARGLFGGIVSKKLSYDCATVNMMMCA 241 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ GK EEA+K+F+EA+ Sbjct: 242 SLREGKTEEAEKFFLEAK 259 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 132 bits (333), Expect = 7e-29 Identities = 64/138 (46%), Positives = 95/138 (68%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+NLL +Y+ SDS S ++V R ++CS +FGF SPR+F+Y LN YVR +RY DA Sbjct: 122 HHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALNGYVRAQRYKDA 181 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 CF +VS ++P + +NN L +L+ +M+ +A+ +F +V + SYDCATV +MM A Sbjct: 182 EDCFYALVSRGVIPCVRILNNFLHSLIRTSMIDEARGLFGGIVSKKLSYDCATVNMMMCA 241 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ GK EEA+K+F+EA+ Sbjct: 242 SLREGKTEEAEKFFLEAK 259 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 130 bits (328), Expect = 3e-28 Identities = 65/134 (48%), Positives = 91/134 (67%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A+ LL YV DS S + V +NC+KRF FEL RVFNYLLN Y+R R +AI CF Sbjct: 481 ARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDCF 540 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 M+ ++PW+PYMN LL+ALV RNM+G+ ++++ +VLR D TV +M++A L+ Sbjct: 541 NAMICQDVIPWVPYMNILLTALVRRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKE 600 Query: 42 GKVEEAQKYFMEAR 1 G+VEEA++YF E + Sbjct: 601 GRVEEAEEYFRETK 614 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 130 bits (328), Expect = 3e-28 Identities = 65/134 (48%), Positives = 91/134 (67%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A+ LL YV DS S + V +NC+KRF FEL RVFNYLLN Y+R R +AI CF Sbjct: 114 ARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDCF 173 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 M+ ++PW+PYMN LL+ALV RNM+G+ ++++ +VLR D TV +M++A L+ Sbjct: 174 NAMICQDVIPWVPYMNILLTALVRRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKE 233 Query: 42 GKVEEAQKYFMEAR 1 G+VEEA++YF E + Sbjct: 234 GRVEEAEEYFRETK 247 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 130 bits (328), Expect = 3e-28 Identities = 65/134 (48%), Positives = 91/134 (67%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A+ LL YV DS S + V +NC+KRF FEL RVFNYLLN Y+R R +AI CF Sbjct: 154 ARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDCF 213 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 M+ ++PW+PYMN LL+ALV RNM+G+ ++++ +VLR D TV +M++A L+ Sbjct: 214 NAMICQDVIPWVPYMNILLTALVRRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKE 273 Query: 42 GKVEEAQKYFMEAR 1 G+VEEA++YF E + Sbjct: 274 GRVEEAEEYFRETK 287 >ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474596|ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474598|ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474601|ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] Length = 864 Score = 130 bits (327), Expect = 3e-28 Identities = 68/138 (49%), Positives = 92/138 (66%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+ LL +Y +SDS SA ++ + VN K F FEL+PRVFN+L+N V+ R TDA Sbjct: 136 HQHKARRLLDNYAFSDSGPSATVVFNGLVNSYKAFDFELNPRVFNFLINSCVKVNRLTDA 195 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 I CF MV +MPWIP MN LL ALV ++M+G A++++ VV R YDC TV ++M A Sbjct: 196 IDCFNRMVELDIMPWIPIMNKLLKALVRQDMIGVARDLYADVVSRGICYDCRTVHILMAA 255 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ GK+EEA + F EA+ Sbjct: 256 CLREGKMEEAVQLFKEAK 273 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 126 bits (317), Expect = 5e-27 Identities = 63/136 (46%), Positives = 92/136 (67%) Frame = -3 Query: 408 SVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIG 229 S +NLL +YV+ DS S ++V + CS R+GFE RVFNYLLN YVR + DA+ Sbjct: 128 SSLRNLLNNYVFGDSSPSPKVLVEHLLECSGRYGFESDSRVFNYLLNSYVRANKIVDAVE 187 Query: 228 CFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFL 49 CFRT++ ++PW+P MN LL+A+V RNM+ A+ ++ +V R DC T+ ++M+A L Sbjct: 188 CFRTLLEHDVIPWVPIMNILLTAMVRRNMICNARQLYDEMVERGMYGDCFTLHVVMRACL 247 Query: 48 QVGKVEEAQKYFMEAR 1 + GK EEA+K+F EA+ Sbjct: 248 KEGKFEEAEKFFKEAK 263 >ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190350|ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190352|ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 124 bits (310), Expect = 3e-26 Identities = 66/138 (47%), Positives = 86/138 (62%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+ LL +Y +SDS SA +I + VNC K F FEL+PRVFN+L+N V+ R DA Sbjct: 136 HQHKARRLLDNYAFSDSGPSATVIFNGLVNCCKAFDFELNPRVFNFLINSCVKVNRLNDA 195 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 I CF MV + PWIP N LL ALV M+G ++++ VV R YD TV ++M A Sbjct: 196 IDCFNEMVELDITPWIPITNKLLKALVRHGMIGVVRDLYTDVVSRGICYDYRTVHILMSA 255 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ GK+EEA K F EA+ Sbjct: 256 CLREGKMEEAVKLFKEAK 273 >ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122855|ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122857|ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122859|ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 123 bits (308), Expect = 5e-26 Identities = 66/138 (47%), Positives = 89/138 (64%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+ LL +Y +SDS SA +I + VN K F FEL+PRVFN+L+N V+ DA Sbjct: 136 HQHKARRLLDNYAFSDSGPSATVIFNGLVNSCKAFDFELNPRVFNFLINSCVKVNGLNDA 195 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 I CF MV +MPWIP MN LL ALV ++M+G A++++ VV R YDC TV ++M A Sbjct: 196 IDCFNGMVELDIMPWIPIMNKLLKALVRQDMIGVARDLYADVVSRGICYDCRTVHILMAA 255 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ K+EEA + F EA+ Sbjct: 256 CLREMKMEEAVRIFKEAK 273 >ref|XP_003607325.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508380|gb|AES89522.1| PPR containing plant-like protein [Medicago truncatula] Length = 834 Score = 122 bits (306), Expect = 9e-26 Identities = 61/131 (46%), Positives = 89/131 (67%) Frame = -3 Query: 393 LLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCFRTM 214 LL +YV+ D+ SA + V + CS R+GFE RVFNYLL +VR + TDA+ CFRTM Sbjct: 117 LLNNYVFGDATPSAKVFVECLLECSGRYGFESDSRVFNYLLKSFVRVNKITDAVECFRTM 176 Query: 213 VSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQVGKV 34 + L+PW+P MNNLL+A+V RNM+ A+ ++ +V R DC T+ ++M+A ++ GK Sbjct: 177 LEHDLVPWVPIMNNLLTAMVRRNMVCDARQLYDEMVERGIYGDCYTLHVVMRACMKEGKF 236 Query: 33 EEAQKYFMEAR 1 EE +K+F EA+ Sbjct: 237 EEVEKFFKEAK 247 >ref|XP_007136983.1| hypothetical protein PHAVU_009G090400g [Phaseolus vulgaris] gi|561010070|gb|ESW08977.1| hypothetical protein PHAVU_009G090400g [Phaseolus vulgaris] Length = 741 Score = 119 bits (297), Expect = 1e-24 Identities = 64/134 (47%), Positives = 88/134 (65%), Gaps = 1/134 (0%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSP-RVFNYLLNVYVRGRRYTDAIGC 226 AK LL +YV+ DS A ++V V C++R+GFELS RVFNYLLN YVR + TDA+ C Sbjct: 116 AKYLLNNYVFGDSAPCAKVLVELLVECAERYGFELSDSRVFNYLLNSYVRANKITDAVEC 175 Query: 225 FRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQ 46 FRTM+ ++PW+P +N LL+A+V RNM V+ +V R DC T+ ++M+A L+ Sbjct: 176 FRTMLEHGVLPWVPIVNILLTAMVRRNMAYNVCQVYDEMVERELYGDCYTLHILMRACLK 235 Query: 45 VGKVEEAQKYFMEA 4 G+ EA YF EA Sbjct: 236 GGRFAEAWNYFEEA 249 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 117 bits (292), Expect = 4e-24 Identities = 62/133 (46%), Positives = 86/133 (64%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A++LL YV DS SA + V +C+KRF FE R+FNYLLN Y+R R DA+ CF Sbjct: 140 AQSLLSLYVSGDSGPSANVFVDHLFDCAKRFEFEPDSRIFNYLLNSYIRANRIRDAVHCF 199 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 MV ++PW+P+MN LL+AL+ RNM +A ++ +VLR D TV ++M+A L+ Sbjct: 200 NKMVEHDILPWVPFMNILLTALIRRNMSREALDLHHKMVLRGVFGDRVTVPVLMRACLKK 259 Query: 42 GKVEEAQKYFMEA 4 + EEA+KYF EA Sbjct: 260 EREEEAEKYFREA 272 >ref|NP_181456.1| pentatricopeptide repeat protein LOJ [Arabidopsis thaliana] gi|75100007|sp|O80958.1|PP194_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g39230, mitochondrial; AltName: Full=Protein LATERAL ORGAN JUNCTION; Flags: Precursor gi|3402682|gb|AAC28985.1| unknown protein [Arabidopsis thaliana] gi|330254554|gb|AEC09648.1| pentatricopeptide repeat protein LOJ [Arabidopsis thaliana] Length = 867 Score = 116 bits (290), Expect = 7e-24 Identities = 58/130 (44%), Positives = 89/130 (68%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A NLL+ +V ++ L ++V+ V+ SKRFGFEL+PR FNYLLN Y+R +R A+ CF Sbjct: 133 ASNLLVMFVSNNPTLIPNVMVNNLVDSSKRFGFELTPRAFNYLLNAYIRNKRMDYAVDCF 192 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 MV +++P++PY+NN+LS+LV N++ +A+ ++ +VL + D T QL+M+A L+ Sbjct: 193 GLMVDRKVVPFVPYVNNVLSSLVRSNLIDEAKEIYNKMVLIGVAGDNVTTQLLMRASLRE 252 Query: 42 GKVEEAQKYF 13 K EEA K F Sbjct: 253 RKPEEAVKIF 262 >ref|XP_006364273.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565397380|ref|XP_006364274.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 854 Score = 115 bits (289), Expect = 9e-24 Identities = 60/138 (43%), Positives = 86/138 (62%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H A+ LL +Y SDS SA II + V C K F FEL+P++FN+L++ V+ R DA Sbjct: 125 HQHKARRLLDYYASSDSGPSATIIFNGLVKCGKTFDFELNPKIFNFLISSCVKANRLNDA 184 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 I CF M+ +M WIP MN LL LV ++M+G A +++ +V R YDC TV ++M A Sbjct: 185 IDCFNGMLEHDIMLWIPIMNRLLKELVRQDMVGVAGDLYTDIVSRGTHYDCRTVHILMAA 244 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ G+++EA K EA+ Sbjct: 245 CLREGRIKEAVKLLEEAK 262 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 115 bits (288), Expect = 1e-23 Identities = 60/137 (43%), Positives = 89/137 (64%) Frame = -3 Query: 411 WSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAI 232 +S+ + LL YV SDS S ++ ++CS+RF F L+ VFNYLLN YVR R DAI Sbjct: 130 YSLTRRLLNSYVSSDSSPSGILLFDHLISCSERFDFPLNSEVFNYLLNSYVRACRNRDAI 189 Query: 231 GCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAF 52 CF MVSC +MP + ++ LSALV R ++ +A+ ++ +V R ++DCA V ++M+A Sbjct: 190 DCFHAMVSCNIMPNVTVVSITLSALVRRKLISEARKMYDDIVGRGINHDCAAVHVIMRAC 249 Query: 51 LQVGKVEEAQKYFMEAR 1 L+ G + EA+K F EA+ Sbjct: 250 LKEGNMVEAEKCFSEAK 266 >ref|XP_002515553.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545497|gb|EEF47002.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 927 Score = 115 bits (287), Expect = 1e-23 Identities = 56/134 (41%), Positives = 88/134 (65%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A+NLL ++ DS I+V F+ +KRF F+ R++NYLLN Y++ + DAIGCF Sbjct: 138 AQNLLNRFISGDSGPMPNILVDHFIGSTKRFDFDSDIRIYNYLLNSYIKANKLNDAIGCF 197 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 +V ++PWI ++N LL+ALV +M+ +A+ V+ +VL+ DC TV +MM+A L+ Sbjct: 198 NRLVESDIVPWIKFLNFLLTALVKNDMIYEAREVYEKMVLKGVHGDCFTVHIMMRANLKD 257 Query: 42 GKVEEAQKYFMEAR 1 EEA+K+F+EA+ Sbjct: 258 NNEEEAKKFFLEAK 271 >ref|XP_002879788.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325627|gb|EFH56047.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 867 Score = 114 bits (285), Expect = 3e-23 Identities = 59/130 (45%), Positives = 86/130 (66%) Frame = -3 Query: 402 AKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDAIGCF 223 A NLL+ +V S+ L + +V+ V+ SKRF FELS R FNYLLN Y+R RR A+ CF Sbjct: 133 ASNLLVMFVSSNPTLIPSAMVNNLVDSSKRFDFELSSRAFNYLLNAYIRNRRMDYAVDCF 192 Query: 222 RTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQAFLQV 43 MV ++P++PY+NN+LS+LV N++ +A+ ++ +VL + D T QL+M+A L+ Sbjct: 193 NLMVDRNVVPFVPYVNNVLSSLVRSNLIDEAKEIYNKMVLIGVAGDNVTTQLLMRASLRE 252 Query: 42 GKVEEAQKYF 13 K EEA K F Sbjct: 253 RKPEEAMKIF 262 >ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722828|ref|XP_010325115.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722831|ref|XP_010325116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722834|ref|XP_010325117.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722837|ref|XP_010325118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722840|ref|XP_010325119.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722845|ref|XP_010325120.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] Length = 850 Score = 112 bits (280), Expect = 1e-22 Identities = 55/138 (39%), Positives = 86/138 (62%) Frame = -3 Query: 414 HWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTDA 235 H ++ LL +Y SDS SA ++ + V C K F F L+P++FN+L++ ++ R DA Sbjct: 121 HQHKSRRLLDYYASSDSGPSATVVFNGLVKCGKTFDFGLNPKIFNFLVSSCMKANRLNDA 180 Query: 234 IGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQA 55 I CF M+ +M WIP MN+LL LV + M+G A++++ +V R YDC TV ++M+A Sbjct: 181 IDCFNAMLEHDIMLWIPIMNSLLKKLVRQGMVGVAEDLYTDIVSRGTHYDCGTVHILMEA 240 Query: 54 FLQVGKVEEAQKYFMEAR 1 L+ GK++EA K E + Sbjct: 241 CLREGKMKEAVKLLEETK 258 >ref|XP_010554554.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Tarenaya hassleriana] Length = 858 Score = 112 bits (279), Expect = 1e-22 Identities = 56/139 (40%), Positives = 92/139 (66%) Frame = -3 Query: 417 EHWSVAKNLLIHYVWSDSVLSAAIIVHRFVNCSKRFGFELSPRVFNYLLNVYVRGRRYTD 238 E ++ A++L+I Y+ + S+ ++ V+R V C+++FGFEL+ R FNYLLN Y+R RR D Sbjct: 131 ETFAPARDLIIRYLSNYSIPKPSVAVNRIVYCAEKFGFELNSRAFNYLLNGYIRARRVDD 190 Query: 237 AIGCFRTMVSCRLMPWIPYMNNLLSALVDRNMLGQAQNVFRCVVLRIGSYDCATVQLMMQ 58 A+ C M+ + +P++ YMN+L SAL+ RN + +A+ ++ +V + D T QL M+ Sbjct: 191 AVDCLNLMLERKAIPFVTYMNSLFSALLRRNSMDEARELYHKMVTLGVTGDNFTTQLFMR 250 Query: 57 AFLQVGKVEEAQKYFMEAR 1 A L+ GK EEA + F +A+ Sbjct: 251 ASLREGKPEEAAEIFGDAK 269