BLASTX nr result
ID: Forsythia21_contig00046365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046365 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012451555.1| PREDICTED: 39S ribosomal protein L41-A, mito... 56 8e-06 ref|XP_012077572.1| PREDICTED: 39S ribosomal protein L41-A, mito... 56 8e-06 >ref|XP_012451555.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial [Gossypium raimondii] gi|728820642|gb|KHG03863.1| 39S ribosomal L41-A, mitochondrial [Gossypium arboreum] gi|763797263|gb|KJB64218.1| hypothetical protein B456_010G037900 [Gossypium raimondii] Length = 92 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -2 Query: 323 LPNYVVPDLIDFKLKPYVSQCASEV--AEAGDSAK 225 LPNYVVPDL DFKLKPYVSQC +EV AEA +SAK Sbjct: 58 LPNYVVPDLTDFKLKPYVSQCPTEVKTAEAAESAK 92 >ref|XP_012077572.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like [Jatropha curcas] gi|802540638|ref|XP_012077577.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like [Jatropha curcas] gi|643739967|gb|KDP45653.1| hypothetical protein JCGZ_17260 [Jatropha curcas] Length = 92 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -2 Query: 323 LPNYVVPDLIDFKLKPYVSQCASEV--AEAGDSAK 225 LPNYV+PDL DFKLKPYVSQCASEV EA ++AK Sbjct: 58 LPNYVIPDLTDFKLKPYVSQCASEVKTTEASEAAK 92