BLASTX nr result
ID: Forsythia21_contig00046165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046165 (317 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094025.1| PREDICTED: organic cation/carnitine transpor... 57 4e-06 >ref|XP_011094025.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum indicum] Length = 492 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 112 MGDRDQSLGYTLDEVLSTVGFGTFQGLALLFSGAGW 5 MGDR+ GYT+DE LS+VGFGTFQGLAL+F+G GW Sbjct: 2 MGDRESD-GYTVDEALSSVGFGTFQGLALVFAGIGW 36