BLASTX nr result
ID: Forsythia21_contig00046071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046071 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ88580.1| hypothetical protein M438DRAFT_371470 [Aureobasid... 62 1e-07 gb|KEQ70545.1| hypothetical protein M436DRAFT_53441 [Aureobasidi... 60 4e-07 gb|KEQ64168.1| hypothetical protein M437DRAFT_74010 [Aureobasidi... 58 3e-06 >gb|KEQ88580.1| hypothetical protein M438DRAFT_371470 [Aureobasidium pullulans EXF-150] Length = 460 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -1 Query: 244 PSWAAPHPHGCNCMVCSRQYMSYHPTAGYPAQTVVG 137 P+W HP GCNCM CSRQYMS+ +GYPAQT VG Sbjct: 425 PTWGGSHPPGCNCMACSRQYMSFMGASGYPAQTAVG 460 >gb|KEQ70545.1| hypothetical protein M436DRAFT_53441 [Aureobasidium namibiae CBS 147.97] Length = 460 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -1 Query: 244 PSWAAPHPHGCNCMVCSRQYMSYHPTAGYPAQTVVG 137 P+W HP GCNCM C+RQYM + +GYPAQTVVG Sbjct: 425 PTWGGSHPPGCNCMTCARQYMPFMGASGYPAQTVVG 460 >gb|KEQ64168.1| hypothetical protein M437DRAFT_74010 [Aureobasidium melanogenum CBS 110374] Length = 454 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -1 Query: 241 SWAAPHPHGCNCMVCSRQYMSYHPTAGYPAQTVVG 137 +W HP GCNCM C+RQYM + +GYPAQTVVG Sbjct: 420 TWGGSHPPGCNCMACARQYMPFMGASGYPAQTVVG 454