BLASTX nr result
ID: Forsythia21_contig00046065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00046065 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092476.1| PREDICTED: uncharacterized protein LOC105172... 47 5e-06 >ref|XP_011092476.1| PREDICTED: uncharacterized protein LOC105172657 [Sesamum indicum] Length = 435 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -1 Query: 193 GSNRVFMIHNGWVLINWCEATLHLNVRAEPD 101 G+NR F+I NGW+L+ + LHLNVRAEPD Sbjct: 124 GNNRGFLIQNGWILVGGSDVKLHLNVRAEPD 154 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 89 KQPVFTYKFSFRLSG 45 KQPVFT KFSFR SG Sbjct: 179 KQPVFTCKFSFRSSG 193