BLASTX nr result
ID: Forsythia21_contig00045755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045755 (392 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010030006.1| PREDICTED: guanosine nucleotide diphosphate ... 64 5e-08 gb|EPS65861.1| hypothetical protein M569_08910, partial [Genlise... 63 9e-08 ref|XP_010101313.1| Rab GDP dissociation inhibitor alpha [Morus ... 62 1e-07 ref|XP_012839019.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_012081659.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_012458453.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_012480054.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 gb|KJB17178.1| hypothetical protein B456_002G268400 [Gossypium r... 62 1e-07 gb|KJB17176.1| hypothetical protein B456_002G268400 [Gossypium r... 62 1e-07 gb|KJB17175.1| hypothetical protein B456_002G268400 [Gossypium r... 62 1e-07 gb|KJB17173.1| hypothetical protein B456_002G268400 [Gossypium r... 62 1e-07 gb|KJB17171.1| hypothetical protein B456_002G268400 [Gossypium r... 62 1e-07 ref|XP_012468578.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011092452.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011074031.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011074023.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011014748.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011005244.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_011004551.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 ref|XP_010907542.1| PREDICTED: guanosine nucleotide diphosphate ... 62 1e-07 >ref|XP_010030006.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor At5g09550 isoform X2 [Eucalyptus grandis] Length = 457 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKVFFAS 263 MDEEYDVIVLGTGLKECILSGLLSVDGLKV + + Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKVLYGA 34 >gb|EPS65861.1| hypothetical protein M569_08910, partial [Genlisea aurea] Length = 449 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 367 KMDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 KMDE+YDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 4 KMDEDYDVIVLGTGLKECILSGLLSVDGLKV 34 >ref|XP_010101313.1| Rab GDP dissociation inhibitor alpha [Morus notabilis] gi|587899889|gb|EXB88260.1| Rab GDP dissociation inhibitor alpha [Morus notabilis] Length = 452 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_012839019.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2-like [Erythranthe guttatus] Length = 440 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_012081659.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor At5g09550-like [Jatropha curcas] Length = 449 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_012458453.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor At5g09550-like [Gossypium raimondii] gi|763810659|gb|KJB77561.1| hypothetical protein B456_012G143800 [Gossypium raimondii] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_012480054.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor At5g09550-like [Gossypium raimondii] gi|763764868|gb|KJB32122.1| hypothetical protein B456_005G225600 [Gossypium raimondii] Length = 445 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >gb|KJB17178.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 424 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >gb|KJB17176.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 446 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >gb|KJB17175.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 445 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >gb|KJB17173.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 423 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >gb|KJB17171.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 416 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_012468578.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2 [Gossypium raimondii] gi|763749731|gb|KJB17170.1| hypothetical protein B456_002G268400 [Gossypium raimondii] gi|763749735|gb|KJB17174.1| hypothetical protein B456_002G268400 [Gossypium raimondii] gi|763749738|gb|KJB17177.1| hypothetical protein B456_002G268400 [Gossypium raimondii] gi|763749740|gb|KJB17179.1| hypothetical protein B456_002G268400 [Gossypium raimondii] gi|763749741|gb|KJB17180.1| hypothetical protein B456_002G268400 [Gossypium raimondii] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011092452.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor At5g09550-like [Sesamum indicum] Length = 445 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011074031.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2-like [Sesamum indicum] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011074023.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2 [Sesamum indicum] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011014748.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2 [Populus euphratica] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011005244.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 1-like [Populus euphratica] gi|743922340|ref|XP_011005245.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 1-like [Populus euphratica] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_011004551.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 1 [Populus euphratica] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30 >ref|XP_010907542.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 2 [Elaeis guineensis] Length = 444 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 364 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 275 MDEEYDVIVLGTGLKECILSGLLSVDGLKV Sbjct: 1 MDEEYDVIVLGTGLKECILSGLLSVDGLKV 30