BLASTX nr result
ID: Forsythia21_contig00045653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045653 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098114.1| PREDICTED: coiled-coil domain-containing pro... 110 5e-22 ref|XP_011098113.1| PREDICTED: coiled-coil domain-containing pro... 110 5e-22 ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing pro... 110 5e-22 gb|ABK25138.1| unknown [Picea sitchensis] 110 5e-22 gb|KMT17358.1| hypothetical protein BVRB_2g038150 isoform B [Bet... 108 1e-21 ref|XP_010669987.1| PREDICTED: coiled-coil domain-containing pro... 108 1e-21 ref|XP_010669986.1| PREDICTED: coiled-coil domain-containing pro... 108 1e-21 emb|CDP06091.1| unnamed protein product [Coffea canephora] 107 2e-21 gb|EEC70982.1| hypothetical protein OsI_02630 [Oryza sativa Indi... 107 2e-21 ref|XP_012849130.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 ref|XP_006644321.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 ref|XP_006355226.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 ref|XP_006843657.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 gb|EMT12470.1| hypothetical protein F775_28326 [Aegilops tauschii] 107 2e-21 gb|EMS68525.1| hypothetical protein TRIUR3_17646 [Triticum urartu] 107 2e-21 ref|XP_004246070.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 ref|XP_010231958.1| PREDICTED: coiled-coil domain-containing pro... 107 2e-21 dbj|BAJ84865.1| predicted protein [Hordeum vulgare subsp. vulgare] 107 2e-21 ref|XP_001781100.1| predicted protein [Physcomitrella patens] gi... 107 2e-21 ref|NP_001043437.1| Os01g0588700 [Oryza sativa Japonica Group] g... 107 2e-21 >ref|XP_011098114.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X3 [Sesamum indicum] Length = 266 Score = 110 bits (274), Expect = 5e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRCGTCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCGTCGNYIYK 52 >ref|XP_011098113.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X2 [Sesamum indicum] Length = 278 Score = 110 bits (274), Expect = 5e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRCGTCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCGTCGNYIYK 52 >ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X1 [Sesamum indicum] Length = 335 Score = 110 bits (274), Expect = 5e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRCGTCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCGTCGNYIYK 52 >gb|ABK25138.1| unknown [Picea sitchensis] Length = 342 Score = 110 bits (274), Expect = 5e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRCGTCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGNYIYK 52 >gb|KMT17358.1| hypothetical protein BVRB_2g038150 isoform B [Beta vulgaris subsp. vulgaris] Length = 340 Score = 108 bits (271), Expect = 1e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYK 52 >ref|XP_010669987.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Beta vulgaris subsp. vulgaris] Length = 253 Score = 108 bits (271), Expect = 1e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYK 52 >ref|XP_010669986.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Beta vulgaris subsp. vulgaris] gi|870866375|gb|KMT17357.1| hypothetical protein BVRB_2g038150 isoform A [Beta vulgaris subsp. vulgaris] Length = 314 Score = 108 bits (271), Expect = 1e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYK 52 >emb|CDP06091.1| unnamed protein product [Coffea canephora] Length = 333 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCNTCGNYIYK 52 >gb|EEC70982.1| hypothetical protein OsI_02630 [Oryza sativa Indica Group] Length = 528 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >ref|XP_012849130.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Erythranthe guttatus] gi|604346238|gb|EYU44701.1| hypothetical protein MIMGU_mgv1a009831mg [Erythranthe guttata] Length = 330 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP KIPRRRQPKNQQ+KVRMML MSIRCGTCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPDKIPRRRQPKNQQMKVRMMLPMSIRCGTCGNYIYK 52 >ref|XP_006644321.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Oryza brachyantha] Length = 327 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >ref|XP_006355226.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Solanum tuberosum] Length = 332 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCATCGNYIYK 52 >ref|XP_006843657.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Amborella trichopoda] gi|548846025|gb|ERN05332.1| hypothetical protein AMTR_s00007p00180710 [Amborella trichopoda] Length = 333 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCSTCGNYIYK 52 >gb|EMT12470.1| hypothetical protein F775_28326 [Aegilops tauschii] Length = 312 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRR+QPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRKQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >gb|EMS68525.1| hypothetical protein TRIUR3_17646 [Triticum urartu] Length = 348 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRR+QPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRKQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >ref|XP_004246070.1| PREDICTED: coiled-coil domain-containing protein 94 [Solanum lycopersicum] Length = 332 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQ+KVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQMKVRMMLPMSIRCATCGNYIYK 52 >ref|XP_010231958.1| PREDICTED: coiled-coil domain-containing protein 94 [Brachypodium distachyon] Length = 331 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >dbj|BAJ84865.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 334 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRR+QPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRKQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52 >ref|XP_001781100.1| predicted protein [Physcomitrella patens] gi|162667497|gb|EDQ54126.1| predicted protein [Physcomitrella patens] Length = 263 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDPAKIPRR+QPKNQQIKVRMML MSIRC TCGNYIYK Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRKQPKNQQIKVRMMLPMSIRCNTCGNYIYK 52 >ref|NP_001043437.1| Os01g0588700 [Oryza sativa Japonica Group] gi|113532968|dbj|BAF05351.1| Os01g0588700 [Oryza sativa Japonica Group] gi|215701327|dbj|BAG92751.1| unnamed protein product [Oryza sativa Japonica Group] Length = 330 Score = 107 bits (268), Expect = 2e-21 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 158 MGERKVLNKYYPPDFDPAKIPRRRQPKNQQIKVRMMLLMSIRCGTCGNYIYK 3 MGERKVLNKYYPPDFDP+KIPRRRQPKNQQIKVRMML MSIRCGTCG YIYK Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGTYIYK 52