BLASTX nr result
ID: Forsythia21_contig00045373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045373 (471 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086814.1| PREDICTED: F-box only protein 6 [Sesamum ind... 66 1e-08 ref|XP_012842139.1| PREDICTED: F-box only protein 6 [Erythranthe... 61 3e-07 >ref|XP_011086814.1| PREDICTED: F-box only protein 6 [Sesamum indicum] Length = 468 Score = 65.9 bits (159), Expect = 1e-08 Identities = 37/63 (58%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -1 Query: 393 MMEGVSILRQFIGQLQELLELYGY--PLSVPSNYFHQFQAQPAPQHNLRSLIYVLAVFIC 220 MMEGV++LRQ IGQLQE+LELYG P +VPSNYF Q QAQP P+ L + C Sbjct: 1 MMEGVAMLRQLIGQLQEVLELYGSPPPHTVPSNYFIQLQAQPQPESQQHPLRW------C 54 Query: 219 LFN 211 LFN Sbjct: 55 LFN 57 >ref|XP_012842139.1| PREDICTED: F-box only protein 6 [Erythranthe guttatus] gi|604327710|gb|EYU33446.1| hypothetical protein MIMGU_mgv1a005881mg [Erythranthe guttata] Length = 466 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/41 (75%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -1 Query: 393 MMEGVSILRQFIGQLQELLELYGY-PLSVPSNYFHQFQAQP 274 MMEGV++LRQ IGQLQE+LELYG P +VPSNYF QFQ QP Sbjct: 1 MMEGVAMLRQLIGQLQEVLELYGSPPPTVPSNYFIQFQPQP 41