BLASTX nr result
ID: Forsythia21_contig00045338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045338 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518631.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002518631.1| conserved hypothetical protein [Ricinus communis] gi|223542230|gb|EEF43773.1| conserved hypothetical protein [Ricinus communis] Length = 796 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -1 Query: 220 MESSSVKLHSRKRKKQYPSPSNPLVGIFTRSKSQVYVHLNRSGRARPDASQ 68 ME + + ++R+ S S+PL+GIFTRSKS++Y+H NRSGRAR D+S+ Sbjct: 1 MEETLQIISKKRRRSSSSSSSHPLMGIFTRSKSKIYLHCNRSGRARSDSSR 51