BLASTX nr result
ID: Forsythia21_contig00045302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045302 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007675758.1| hypothetical protein BAUCODRAFT_147423 [Baud... 68 3e-09 >ref|XP_007675758.1| hypothetical protein BAUCODRAFT_147423 [Baudoinia compniacensis UAMH 10762] gi|449301312|gb|EMC97323.1| hypothetical protein BAUCODRAFT_147423 [Baudoinia compniacensis UAMH 10762] Length = 268 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 QENPNRQLSYFIVTFSAKYLPYSMLAMTFVMASPQAAL 3 QENPNRQLSYFI+TFSAK+LP+ MLAMTFVM SPQ A+ Sbjct: 135 QENPNRQLSYFIITFSAKWLPFVMLAMTFVMGSPQEAM 172