BLASTX nr result
ID: Forsythia21_contig00045295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00045295 (349 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266556.1| PREDICTED: B2 protein-like [Nelumbo nucifera] 59 2e-06 ref|XP_012854103.1| PREDICTED: B2 protein [Erythranthe guttatus] 57 5e-06 ref|XP_011082302.1| PREDICTED: B2 protein [Sesamum indicum] 57 5e-06 ref|XP_009590115.1| PREDICTED: B2 protein-like [Nicotiana toment... 57 5e-06 emb|CDP12181.1| unnamed protein product [Coffea canephora] 57 5e-06 gb|EYU23311.1| hypothetical protein MIMGU_mgv1a010649mg [Erythra... 57 5e-06 gb|EPS66990.1| hypothetical protein M569_07785, partial [Genlise... 57 5e-06 gb|KJB24185.1| hypothetical protein B456_004G131900 [Gossypium r... 57 6e-06 ref|XP_010267585.1| PREDICTED: B2 protein [Nelumbo nucifera] 57 6e-06 gb|KGN53423.1| hypothetical protein Csa_4G052730 [Cucumis sativus] 56 8e-06 ref|XP_008451926.1| PREDICTED: probable serine/threonine-protein... 56 8e-06 ref|XP_004148988.1| PREDICTED: uncharacterized protein DDB_G0283... 56 8e-06 >ref|XP_010266556.1| PREDICTED: B2 protein-like [Nelumbo nucifera] Length = 306 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDPTAWEDKKNPGESRFPAQV Sbjct: 233 GGTNIDPTAWEDKKNPGESRFPAQV 257 >ref|XP_012854103.1| PREDICTED: B2 protein [Erythranthe guttatus] Length = 307 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP+AWEDKKNPGESRFPAQV Sbjct: 235 GGTNIDPSAWEDKKNPGESRFPAQV 259 >ref|XP_011082302.1| PREDICTED: B2 protein [Sesamum indicum] Length = 334 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP+AWEDKKNPGESRFPAQV Sbjct: 261 GGTNIDPSAWEDKKNPGESRFPAQV 285 >ref|XP_009590115.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis] Length = 317 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GG+NIDPTAWEDKKNPGESRFPAQV Sbjct: 238 GGSNIDPTAWEDKKNPGESRFPAQV 262 >emb|CDP12181.1| unnamed protein product [Coffea canephora] Length = 121 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP+AWEDKKNPGESRFPAQV Sbjct: 49 GGTNIDPSAWEDKKNPGESRFPAQV 73 >gb|EYU23311.1| hypothetical protein MIMGU_mgv1a010649mg [Erythranthe guttata] Length = 306 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP+AWEDKKNPGESRFPAQV Sbjct: 240 GGTNIDPSAWEDKKNPGESRFPAQV 264 >gb|EPS66990.1| hypothetical protein M569_07785, partial [Genlisea aurea] Length = 321 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP+AWEDKKNPGESRFPAQV Sbjct: 249 GGTNIDPSAWEDKKNPGESRFPAQV 273 >gb|KJB24185.1| hypothetical protein B456_004G131900 [Gossypium raimondii] gi|763756856|gb|KJB24187.1| hypothetical protein B456_004G131900 [Gossypium raimondii] Length = 271 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQVCYPTL 260 GGTNIDPTAWEDKK PGESRFPAQV P + Sbjct: 240 GGTNIDPTAWEDKKCPGESRFPAQVFCPPI 269 >ref|XP_010267585.1| PREDICTED: B2 protein [Nelumbo nucifera] Length = 338 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDP AWEDKKNPGESRFPAQV Sbjct: 265 GGTNIDPAAWEDKKNPGESRFPAQV 289 >gb|KGN53423.1| hypothetical protein Csa_4G052730 [Cucumis sativus] Length = 344 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDPTAWEDKK PGESRFPAQV Sbjct: 271 GGTNIDPTAWEDKKTPGESRFPAQV 295 >ref|XP_008451926.1| PREDICTED: probable serine/threonine-protein kinase clkA [Cucumis melo] Length = 371 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDPTAWEDKK PGESRFPAQV Sbjct: 298 GGTNIDPTAWEDKKTPGESRFPAQV 322 >ref|XP_004148988.1| PREDICTED: uncharacterized protein DDB_G0283357 [Cucumis sativus] Length = 371 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 349 GGTNIDPTAWEDKKNPGESRFPAQV 275 GGTNIDPTAWEDKK PGESRFPAQV Sbjct: 298 GGTNIDPTAWEDKKTPGESRFPAQV 322