BLASTX nr result
ID: Forsythia21_contig00043899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043899 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099237.1| Alkaline ceramidase 3 [Morus notabilis] gi|5... 56 8e-06 ref|XP_006420967.1| hypothetical protein CICLE_v10005697mg [Citr... 56 8e-06 >ref|XP_010099237.1| Alkaline ceramidase 3 [Morus notabilis] gi|587959330|gb|EXC44822.1| Alkaline ceramidase 3 [Morus notabilis] Length = 179 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 91 FRILFFRQQQGDETPMVWEMLLYIYILYSP 2 F+ L RQQQ DETPMVWEMLLYIYILYSP Sbjct: 3 FKTLICRQQQSDETPMVWEMLLYIYILYSP 32 >ref|XP_006420967.1| hypothetical protein CICLE_v10005697mg [Citrus clementina] gi|557522840|gb|ESR34207.1| hypothetical protein CICLE_v10005697mg [Citrus clementina] Length = 190 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 91 FRILFFRQQQGDETPMVWEMLLYIYILYSP 2 F + RQQQGDETPMVWEMLLYIYILYSP Sbjct: 14 FIYVLIRQQQGDETPMVWEMLLYIYILYSP 43