BLASTX nr result
ID: Forsythia21_contig00043846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043846 (356 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583907.1| hypothetical protein UCRNP2_4625 [Neofusicoc... 90 7e-16 >ref|XP_007583907.1| hypothetical protein UCRNP2_4625 [Neofusicoccum parvum UCRNP2] gi|485923453|gb|EOD48617.1| hypothetical protein UCRNP2_4625 [Neofusicoccum parvum UCRNP2] Length = 141 Score = 89.7 bits (221), Expect = 7e-16 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 1/88 (1%) Frame = -1 Query: 263 FGQFDQETGSSAVDSSYLVPFSLLPPQLVTSLERDFELLISEGPTDLIQIVTGALTFQPS 84 FGQFD TG S V S Y+VP +LLPP L+ +D LL+++GP L ++ GALTF Sbjct: 51 FGQFDTATGKSTVSSDYVVPLALLPPSLLDRTLKDVGLLVTQGPESLTTVIVGALTFDEV 110 Query: 83 VSKRDGEVK-RQVPITGLIGNFLAQLIG 3 + D +K RQVP+TG IGNF+AQLIG Sbjct: 111 NNPSDKMLKERQVPLTGPIGNFVAQLIG 138