BLASTX nr result
ID: Forsythia21_contig00043766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043766 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093233.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_012845259.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-20 ref|XP_008338038.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_010689314.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 gb|KDO71020.1| hypothetical protein CISIN_1g038673mg [Citrus sin... 102 1e-19 ref|XP_006466854.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_006425612.1| hypothetical protein CICLE_v10025108mg [Citr... 102 1e-19 ref|XP_006340666.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_008241735.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_007203772.1| hypothetical protein PRUPE_ppa002597mg [Prun... 100 3e-19 ref|XP_009624583.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_011028546.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_009773656.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Popu... 99 1e-18 ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_012080313.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 emb|CBI17453.3| unnamed protein product [Vitis vinifera] 98 2e-18 ref|XP_003629742.1| Pentatricopeptide repeat-containing protein ... 98 2e-18 ref|XP_010109916.1| hypothetical protein L484_013254 [Morus nota... 97 4e-18 >ref|XP_011093233.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Sesamum indicum] gi|747091037|ref|XP_011093234.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Sesamum indicum] Length = 652 Score = 108 bits (271), Expect = 1e-21 Identities = 49/56 (87%), Positives = 49/56 (87%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TDD IRIVKNLRICEDCHLFMCGASQIT REIIVRDNMRFHHF DG CSC NFW Sbjct: 597 TDDSSTIRIVKNLRICEDCHLFMCGASQITGREIIVRDNMRFHHFCDGACSCCNFW 652 >ref|XP_012845259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Erythranthe guttatus] gi|604320014|gb|EYU31178.1| hypothetical protein MIMGU_mgv1a027138mg [Erythranthe guttata] Length = 654 Score = 104 bits (259), Expect = 3e-20 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = -2 Query: 248 DDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 +DG AIRIVKNLRIC DCHLFMCG S+I++R+IIVRDNMRFHHF DG CSC NFW Sbjct: 600 EDGSAIRIVKNLRICVDCHLFMCGVSEISRRKIIVRDNMRFHHFEDGACSCRNFW 654 >ref|XP_008338038.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Malus domestica] Length = 651 Score = 103 bits (258), Expect = 3e-20 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD I+I+KN+RICEDCH FMCGASQ+T REI+VRDNMRFHHFH+GTCSC NFW Sbjct: 596 TDSVSTIKIMKNIRICEDCHSFMCGASQVTGREIVVRDNMRFHHFHNGTCSCGNFW 651 >ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Vitis vinifera] Length = 647 Score = 102 bits (254), Expect = 1e-19 Identities = 45/56 (80%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T+ G IRIVKNLRICEDCH MCGASQIT REI+VRDNMRFHHF DG CSC NFW Sbjct: 592 TNAGCTIRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGRCSCGNFW 647 >ref|XP_010689314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Beta vulgaris subsp. vulgaris] gi|870850065|gb|KMT02216.1| hypothetical protein BVRB_9g206760 [Beta vulgaris subsp. vulgaris] Length = 658 Score = 102 bits (253), Expect = 1e-19 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T+ IRI+KNLRICEDCH+FMCGAS++ REI++RDNMRFHHFHDG CSC NFW Sbjct: 603 TESTHTIRIMKNLRICEDCHIFMCGASKVAGREIVIRDNMRFHHFHDGACSCGNFW 658 >gb|KDO71020.1| hypothetical protein CISIN_1g038673mg [Citrus sinensis] Length = 548 Score = 102 bits (253), Expect = 1e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G +RI+KNLRICEDCHLFMCGASQ+ REI+VRDNMRFHHF DG CSC N+W Sbjct: 493 TSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW 548 >ref|XP_006466854.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X1 [Citrus sinensis] gi|568824952|ref|XP_006466855.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X2 [Citrus sinensis] gi|568824954|ref|XP_006466856.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X3 [Citrus sinensis] gi|568824956|ref|XP_006466857.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like isoform X4 [Citrus sinensis] Length = 653 Score = 102 bits (253), Expect = 1e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G +RI+KNLRICEDCHLFMCGASQ+ REI+VRDNMRFHHF DG CSC N+W Sbjct: 598 TSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW 653 >ref|XP_006425612.1| hypothetical protein CICLE_v10025108mg [Citrus clementina] gi|557527602|gb|ESR38852.1| hypothetical protein CICLE_v10025108mg [Citrus clementina] Length = 653 Score = 102 bits (253), Expect = 1e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G +RI+KNLRICEDCHLFMCGASQ+ REI+VRDNMRFHHF DG CSC N+W Sbjct: 598 TSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW 653 >ref|XP_006340666.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Solanum tuberosum] Length = 654 Score = 101 bits (252), Expect = 2e-19 Identities = 44/53 (83%), Positives = 46/53 (86%) Frame = -2 Query: 242 GLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 G IRI+KNLRICEDCH FMCGASQIT REIIVRDN RFHHFH+G CSC NFW Sbjct: 602 GSTIRIMKNLRICEDCHSFMCGASQITGREIIVRDNKRFHHFHNGVCSCGNFW 654 >ref|XP_008241735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Prunus mume] Length = 654 Score = 100 bits (250), Expect = 3e-19 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD G I+I+KN+RICEDCH+FMCGASQ+ REI+VRDNMRFHHF +G CSC NFW Sbjct: 599 TDSGSTIKIMKNIRICEDCHVFMCGASQVAGREIVVRDNMRFHHFSNGKCSCGNFW 654 >ref|XP_007203772.1| hypothetical protein PRUPE_ppa002597mg [Prunus persica] gi|462399303|gb|EMJ04971.1| hypothetical protein PRUPE_ppa002597mg [Prunus persica] Length = 654 Score = 100 bits (250), Expect = 3e-19 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD G I+I+KN+RICEDCH+FMCGASQ+ REI+VRDNMRFHHF +G CSC NFW Sbjct: 599 TDSGSTIKIMKNIRICEDCHVFMCGASQVAGREIVVRDNMRFHHFSNGKCSCGNFW 654 >ref|XP_009624583.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Nicotiana tomentosiformis] Length = 653 Score = 99.8 bits (247), Expect = 6e-19 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD+ IRI+KNLRICEDCH FMCGASQIT REII+RDN RFHHF +G CSC NFW Sbjct: 598 TDNESTIRIMKNLRICEDCHSFMCGASQITGREIIIRDNKRFHHFRNGVCSCGNFW 653 >ref|XP_011028546.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Populus euphratica] Length = 654 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/56 (80%), Positives = 46/56 (82%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G IRIVKNLRICEDCH +CGASQIT REIIVRD MRFHHFHDG CSC NFW Sbjct: 599 TIPGSKIRIVKNLRICEDCHSVICGASQITGREIIVRDIMRFHHFHDGICSCGNFW 654 >ref|XP_009773656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Nicotiana sylvestris] Length = 653 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD G IRI+KNLRICEDCH FMCGASQ+ REII+RDN RFHHF +G CSC NFW Sbjct: 598 TDTGSIIRIMKNLRICEDCHSFMCGASQVIGREIIIRDNKRFHHFRNGVCSCGNFW 653 >ref|XP_006383156.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa] gi|550338737|gb|ERP60953.1| hypothetical protein POPTR_0005s12100g [Populus trichocarpa] Length = 654 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/56 (80%), Positives = 46/56 (82%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G IRIVKNLRICEDCH +CGASQIT REIIVRD MRFHHFHDG CSC NFW Sbjct: 599 TIPGSKIRIVKNLRICEDCHSVICGASQITGREIIVRDIMRFHHFHDGICSCGNFW 654 >ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Cucumis sativus] gi|700198130|gb|KGN53288.1| hypothetical protein Csa_4G045030 [Cucumis sativus] Length = 650 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T+ G I+I+KN+RICEDCH MC AS+IT REIIVRDNMRFHHFH+GTCSC NFW Sbjct: 595 TEAGDTIKIMKNIRICEDCHNVMCAASEITGREIIVRDNMRFHHFHNGTCSCGNFW 650 >ref|XP_012080313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 [Jatropha curcas] gi|643721026|gb|KDP31290.1| hypothetical protein JCGZ_11666 [Jatropha curcas] Length = 654 Score = 98.2 bits (243), Expect = 2e-18 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 T G I+I+KNLRIC+DCHLFM GASQI REIIVRDNMRFHHFH+G CSC NFW Sbjct: 599 TSPGCPIKIMKNLRICQDCHLFMRGASQIMGREIIVRDNMRFHHFHNGICSCGNFW 654 >emb|CBI17453.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/55 (80%), Positives = 46/55 (83%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNF 87 T+ G IRIVKNLRICEDCH MCGASQIT REI+VRDNMRFHHF DG CSC NF Sbjct: 374 TNAGCTIRIVKNLRICEDCHSVMCGASQITGREIVVRDNMRFHHFRDGRCSCGNF 428 >ref|XP_003629742.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523764|gb|AET04218.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 616 Score = 98.2 bits (243), Expect = 2e-18 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -2 Query: 251 TDDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 TD G I+I+KNLRICEDCH+ MCGAS++T R+IIVRDNMRFHHF +G CSC+NFW Sbjct: 561 TDAGSTIKIMKNLRICEDCHIVMCGASKLTGRKIIVRDNMRFHHFLNGACSCNNFW 616 >ref|XP_010109916.1| hypothetical protein L484_013254 [Morus notabilis] gi|587938112|gb|EXC24885.1| hypothetical protein L484_013254 [Morus notabilis] Length = 615 Score = 97.1 bits (240), Expect = 4e-18 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -2 Query: 248 DDGLAIRIVKNLRICEDCHLFMCGASQITQREIIVRDNMRFHHFHDGTCSCHNFW 84 D G I+I+KNLRICEDCH+ MCGAS+IT REII+RDNMRFHHF DG CSC +FW Sbjct: 561 DGGCTIKIMKNLRICEDCHVVMCGASKITGREIIIRDNMRFHHFCDGKCSCGDFW 615