BLASTX nr result
ID: Forsythia21_contig00043617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043617 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lo... 91 2e-16 gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendr... 90 5e-16 ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 89 2e-15 ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fi... 88 2e-15 ref|XP_009216517.1| 30S ribosomal protein S14p/S29e [Gaeumannomy... 88 2e-15 ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea ... 88 2e-15 ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunne... 88 3e-15 ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe... 87 4e-15 gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 87 4e-15 gb|KLU88382.1| 30S ribosomal protein S14p/S29e [Magnaporthiopsis... 87 6e-15 ref|XP_001229052.1| 40S ribosomal protein S29 [Chaetomium globos... 86 8e-15 ref|XP_001912016.1| hypothetical protein [Podospora anserina S m... 86 8e-15 gb|EPQ65083.1| Protein component of the small (40S) ribosomal su... 86 1e-14 ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baud... 86 1e-14 ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 86 1e-14 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 86 1e-14 gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum ... 86 1e-14 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 86 1e-14 gb|KJY00131.1| 40S ribosomal protein S29 [Zymoseptoria brevis] 85 2e-14 gb|KEQ88480.1| ribosomal protein S14 [Aureobasidium pullulans EX... 85 2e-14 >ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] gi|512205853|gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] Length = 56 Score = 91.3 bits (225), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR Sbjct: 16 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendron maius Zn] Length = 56 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVCTHKAGLIRKYGLNICRQCFREKA+DIGFVKHR Sbjct: 16 KGARACRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR CRVCTHKAGLIRKYGLNICRQCFREKA+DIGFVKHR Sbjct: 16 KGARGCRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] gi|573060572|gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR CRVCTHKAGLIRKYGLNICRQCFREK+ADIGFVKHR Sbjct: 16 KGARQCRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_009216517.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402085610|gb|EJT80508.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 56 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVCTH+AGLIRKYGL+ICRQCFREKAADIGFVKHR Sbjct: 16 KGARACRVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botrytis cinerea T4] Length = 56 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R CRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR Sbjct: 16 KGSRECRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_007289694.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866814|gb|EKD19853.1| 40S ribosomal protein S29 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 130 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVCTHKAGLIRKYGLNICRQCFREKA DIGFVKH+ Sbjct: 16 KGARACRVCTHKAGLIRKYGLNICRQCFREKAHDIGFVKHK 56 >ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|544604595|sp|P0CT15.1|RS29_MAGO7 RecName: Full=40S ribosomal protein S29 [Magnaporthe oryzae 70-15] gi|544604597|sp|L7IM20.1|RS29_MAGOY RecName: Full=40S ribosomal protein S29 gi|59802952|gb|AAX07680.1| 40S ribosomal protein S29-like protein [Magnaporthe grisea] gi|351647466|gb|EHA55326.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|440475624|gb|ELQ44293.1| hypothetical protein OOU_Y34scaffold00094g84 [Magnaporthe oryzae Y34] gi|440480842|gb|ELQ61483.1| hypothetical protein OOW_P131scaffold01180g11 [Magnaporthe oryzae P131] Length = 56 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR+CRVCTH+AGLIRKYGL+ICRQCFREKAADIGFVKHR Sbjct: 16 KGARSCRVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVCTHKAGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 16 KGARACRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >gb|KLU88382.1| 30S ribosomal protein S14p/S29e [Magnaporthiopsis poae ATCC 64411] Length = 56 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGARACRVC+H+AGLIRKYGL+ICRQCFREKAADIGFVKHR Sbjct: 16 KGARACRVCSHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >ref|XP_001229052.1| 40S ribosomal protein S29 [Chaetomium globosum CBS 148.51] gi|88183133|gb|EAQ90601.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 56 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+RACRVCTH+AGLIRKYGLNICRQCFREKAADIGFVK+R Sbjct: 16 KGSRACRVCTHQAGLIRKYGLNICRQCFREKAADIGFVKYR 56 >ref|XP_001912016.1| hypothetical protein [Podospora anserina S mat+] gi|170947040|emb|CAP73845.1| unnamed protein product [Podospora anserina S mat+] gi|681096115|emb|CDP26244.1| Putative cytosolic 40S ribosomal protein Rps29 [Podospora anserina S mat+] Length = 56 Score = 86.3 bits (212), Expect = 8e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+RACRVCTH+AGLIRKYGLNICRQCFREKAADIGFVK+R Sbjct: 16 KGSRACRVCTHQAGLIRKYGLNICRQCFREKAADIGFVKYR 56 >gb|EPQ65083.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528300960|emb|CCU75163.1| 40S ribosomal protein S29 [Blumeria graminis f. sp. hordei DH14] Length = 56 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R+CRVCTHKAGLIRKYGL+ICRQCFREKA+DIGFVKHR Sbjct: 16 KGSRSCRVCTHKAGLIRKYGLDICRQCFREKASDIGFVKHR 56 >ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] gi|449301790|gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR+CRVCTH+AGLIRKYGLNICRQCFREK+ADIGF KHR Sbjct: 16 KGARSCRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR CRVCTH AGLIRKYGLNICRQCFREK+ADIGFVKHR Sbjct: 78 KGARECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 118 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R CRVCTH AGLIRKYGLNICRQCFREKAADIGFVKHR Sbjct: 16 KGSRECRVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum CBS 110374] Length = 56 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R CRVCTHKAGLIRKYGLNICRQCFREK+ DIGFVKHR Sbjct: 16 KGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KGAR CRVCTHKAGLIRKYGLNICRQCFREK++DIGF KHR Sbjct: 16 KGARECRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >gb|KJY00131.1| 40S ribosomal protein S29 [Zymoseptoria brevis] Length = 56 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R CRVCTH+AGLIRKYGLNICRQCFREKAADIGF KHR Sbjct: 16 KGSRECRVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56 >gb|KEQ88480.1| ribosomal protein S14 [Aureobasidium pullulans EXF-150] gi|662538509|gb|KEQ95815.1| hypothetical protein AUEXF2481DRAFT_691941 [Aureobasidium subglaciale EXF-2481] Length = 56 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 261 KGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 139 KG+R CRVCTHKAGLIRKYGLNICRQCFREK+ DIGF+KHR Sbjct: 16 KGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKHR 56