BLASTX nr result
ID: Forsythia21_contig00043486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043486 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY19838.1| putative ubiquitin-like protein [Diplodia seriata] 96 1e-17 ref|XP_007782537.1| hypothetical protein W97_06473 [Coniosporium... 96 1e-17 ref|XP_002418942.1| ubiquitin domain-containing protein, putativ... 92 1e-16 ref|XP_003868982.1| ubiquitin-like polyubiquitin-binding protein... 92 1e-16 gb|EKG18290.1| Ubiquitin-associated/translation elongation facto... 92 1e-16 ref|XP_011126980.1| hypothetical protein AOL_s00193g67 [Arthrobo... 92 1e-16 ref|XP_001212566.1| deubiquitination-protection protein dph1 [As... 92 1e-16 gb|KKK25761.1| ubiquitin-like protein [Aspergillus rambellii] 92 2e-16 gb|KKK13680.1| ubiquitin-like protein [Aspergillus ochraceoroseus] 92 2e-16 gb|EMG49419.1| hypothetical protein G210_5832 [Candida maltosa X... 91 2e-16 emb|CCE44970.1| hypothetical protein CPAR2_407730 [Candida parap... 91 2e-16 ref|XP_002547743.1| conserved hypothetical protein [Candida trop... 91 2e-16 ref|XP_007374218.1| hypothetical protein SPAPADRAFT_60059 [Spath... 91 3e-16 ref|XP_001268397.1| ubiquitin-like protein DskB, putative [Asper... 91 3e-16 gb|KMK63634.1| ubiquitin-like protein DskB [Aspergillus fumigatu... 91 4e-16 gb|KJK64824.1| Ubiquitin-like domain of Scythe protein [Aspergil... 91 4e-16 gb|KJJ35518.1| Ubiquitin family protein [Aspergillus flavus AF70] 91 4e-16 ref|XP_003005733.1| deubiquitination-protection protein dph1 [Ve... 91 4e-16 dbj|GAD95703.1| multispanning membrane protein [Byssochlamys spe... 91 4e-16 ref|XP_001819646.1| ubiquitin-like protein DskB [Aspergillus ory... 91 4e-16 >gb|KKY19838.1| putative ubiquitin-like protein [Diplodia seriata] Length = 467 Score = 95.5 bits (236), Expect = 1e-17 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 AP DN PPEERYA QLRQLNDMGFYEFERN+QALRRSGGSVQGA+EYL +G Sbjct: 416 APPDNRPPEERYAEQLRQLNDMGFYEFERNIQALRRSGGSVQGAVEYLLNG 466 >ref|XP_007782537.1| hypothetical protein W97_06473 [Coniosporium apollinis CBS 100218] gi|494830695|gb|EON67220.1| hypothetical protein W97_06473 [Coniosporium apollinis CBS 100218] Length = 489 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 P DN PPEERYA QLRQLNDMGFYEFERNVQALRRSGGSVQGA+EYL SG Sbjct: 439 PPDNRPPEERYAEQLRQLNDMGFYEFERNVQALRRSGGSVQGAVEYLLSG 488 >ref|XP_002418942.1| ubiquitin domain-containing protein, putative [Candida dubliniensis CD36] gi|223642281|emb|CAX44250.1| ubiquitin domain-containing protein, putative [Candida dubliniensis CD36] Length = 325 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 APVDN PPEERY +QLRQLNDMGFY+F+RNV+ALRR+GGSVQGAIEYL G Sbjct: 274 APVDNRPPEERYESQLRQLNDMGFYDFDRNVEALRRTGGSVQGAIEYLLGG 324 >ref|XP_003868982.1| ubiquitin-like polyubiquitin-binding protein [Candida orthopsilosis Co 90-125] gi|380353322|emb|CCG26078.1| ubiquitin-like polyubiquitin-binding protein [Candida orthopsilosis] Length = 359 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 AP DN PPEERY AQLRQLNDMGFYEFERNV+ALRR+GGSVQGAIEYL + Sbjct: 309 APADNRPPEERYEAQLRQLNDMGFYEFERNVEALRRTGGSVQGAIEYLLN 358 >gb|EKG18290.1| Ubiquitin-associated/translation elongation factor EF1B [Macrophomina phaseolina MS6] Length = 468 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 P DN PPEERYA QLRQLNDMGF+EFERN+QALRRSGGSVQGA+EYL +G Sbjct: 418 PPDNRPPEERYADQLRQLNDMGFFEFERNIQALRRSGGSVQGAVEYLLNG 467 >ref|XP_011126980.1| hypothetical protein AOL_s00193g67 [Arthrobotrys oligospora ATCC 24927] gi|345561243|gb|EGX44339.1| hypothetical protein AOL_s00193g67 [Arthrobotrys oligospora ATCC 24927] Length = 491 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 PVDN PPEERYA QLRQLNDMGF++F+RNV ALRRSGGSVQGAIEYL SG Sbjct: 441 PVDNRPPEERYAEQLRQLNDMGFFDFDRNVAALRRSGGSVQGAIEYLLSG 490 >ref|XP_001212566.1| deubiquitination-protection protein dph1 [Aspergillus terreus NIH2624] gi|114194962|gb|EAU36662.1| deubiquitination-protection protein dph1 [Aspergillus terreus NIH2624] Length = 469 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 P DN PPEERYA QLRQLNDMGF+EFERN++ALRRSGGSVQGA+EYL SG Sbjct: 419 PQDNRPPEERYADQLRQLNDMGFFEFERNIEALRRSGGSVQGAVEYLLSG 468 >gb|KKK25761.1| ubiquitin-like protein [Aspergillus rambellii] Length = 460 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 AP DN PPEERYA QLRQLNDMGFYEFERN++ALRR+GGSVQGA+EYL S Sbjct: 408 APPDNRPPEERYADQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLS 457 >gb|KKK13680.1| ubiquitin-like protein [Aspergillus ochraceoroseus] Length = 471 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 AP DN PPEERYA QLRQLNDMGFYEFERN++ALRR+GGSVQGA+EYL S Sbjct: 419 APPDNRPPEERYADQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLS 468 >gb|EMG49419.1| hypothetical protein G210_5832 [Candida maltosa Xu316] Length = 349 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 APVDN PPEERY QLRQLNDMGFY+F+RNV+ALRR+GGSVQGAIEYL G Sbjct: 298 APVDNRPPEERYENQLRQLNDMGFYDFDRNVEALRRTGGSVQGAIEYLLGG 348 >emb|CCE44970.1| hypothetical protein CPAR2_407730 [Candida parapsilosis] Length = 364 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 AP DN PPEERY +QLRQLNDMGFYEFERNV+ALRR+GGSVQGAIEYL + Sbjct: 314 APADNRPPEERYESQLRQLNDMGFYEFERNVEALRRTGGSVQGAIEYLLN 363 >ref|XP_002547743.1| conserved hypothetical protein [Candida tropicalis MYA-3404] gi|240135634|gb|EER35188.1| conserved hypothetical protein [Candida tropicalis MYA-3404] Length = 357 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 APVDN PPEERY QLRQLNDMGFY+F+RNV+ALRR+GGSVQGAIEYL G Sbjct: 306 APVDNRPPEERYENQLRQLNDMGFYDFDRNVEALRRTGGSVQGAIEYLLGG 356 >ref|XP_007374218.1| hypothetical protein SPAPADRAFT_60059 [Spathaspora passalidarum NRRL Y-27907] gi|344302429|gb|EGW32703.1| hypothetical protein SPAPADRAFT_60059 [Spathaspora passalidarum NRRL Y-27907] Length = 368 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 APVDN PPEERY +QLRQLNDMGF++F+RNV+ALRR+GGSVQGAIEYL G Sbjct: 317 APVDNRPPEERYESQLRQLNDMGFFDFDRNVEALRRTGGSVQGAIEYLLGG 367 >ref|XP_001268397.1| ubiquitin-like protein DskB, putative [Aspergillus clavatus NRRL 1] gi|119396539|gb|EAW06971.1| ubiquitin-like protein DskB, putative [Aspergillus clavatus NRRL 1] Length = 476 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 P DN PPEERYA QLRQLNDMGF+EFERNV+ALRRSGGSVQGAIEYL S Sbjct: 425 PQDNRPPEERYAEQLRQLNDMGFFEFERNVEALRRSGGSVQGAIEYLLS 473 >gb|KMK63634.1| ubiquitin-like protein DskB [Aspergillus fumigatus Z5] Length = 472 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 P DN PPEERYA QLRQLNDMGF+EFERNV+ALRRSGGSVQGAIEYL S Sbjct: 421 PQDNRPPEERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAIEYLLS 469 >gb|KJK64824.1| Ubiquitin-like domain of Scythe protein [Aspergillus parasiticus SU-1] Length = 469 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 P DN PPEERYA QLRQLNDMGFYEFERN++ALRR+GGSVQGA+EYL S Sbjct: 418 PQDNRPPEERYAEQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLS 466 >gb|KJJ35518.1| Ubiquitin family protein [Aspergillus flavus AF70] Length = 469 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 P DN PPEERYA QLRQLNDMGFYEFERN++ALRR+GGSVQGA+EYL S Sbjct: 418 PQDNRPPEERYAEQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLS 466 >ref|XP_003005733.1| deubiquitination-protection protein dph1 [Verticillium alfalfae VaMs.102] gi|261355149|gb|EEY17577.1| deubiquitination-protection protein dph1 [Verticillium alfalfae VaMs.102] Length = 413 Score = 90.5 bits (223), Expect = 4e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFSG 17 AP DN PPEERYA QLRQLNDMGFY+F+RNV ALRRSGGSVQGA+E+L SG Sbjct: 344 APPDNRPPEERYAEQLRQLNDMGFYDFDRNVAALRRSGGSVQGAVEHLLSG 394 >dbj|GAD95703.1| multispanning membrane protein [Byssochlamys spectabilis No. 5] Length = 1214 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 169 APVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 AP DN PPEERYA QLRQLNDMGF+EFERN++ALRRSGGSVQGA+EYL + Sbjct: 413 APPDNRPPEERYAEQLRQLNDMGFFEFERNIEALRRSGGSVQGAVEYLLN 462 >ref|XP_001819646.1| ubiquitin-like protein DskB [Aspergillus oryzae RIB40] gi|238487248|ref|XP_002374862.1| ubiquitin-like protein DskB, putative [Aspergillus flavus NRRL3357] gi|83767505|dbj|BAE57644.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699741|gb|EED56080.1| ubiquitin-like protein DskB, putative [Aspergillus flavus NRRL3357] Length = 469 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 166 PVDNTPPEERYAAQLRQLNDMGFYEFERNVQALRRSGGSVQGAIEYLFS 20 P DN PPEERYA QLRQLNDMGFYEFERN++ALRR+GGSVQGA+EYL S Sbjct: 418 PQDNRPPEERYAEQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLS 466