BLASTX nr result
ID: Forsythia21_contig00043474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043474 (604 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB56763.1| hypothetical protein B456_009G135100 [Gossypium r... 57 9e-06 >gb|KJB56763.1| hypothetical protein B456_009G135100 [Gossypium raimondii] Length = 783 Score = 56.6 bits (135), Expect = 9e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -2 Query: 207 WDIMSNGSPVQCIGYLAKGQDRGNAVTIQVSPVFC 103 WDIMSNG PVQ I LAKG+DRGNAVTIQVS C Sbjct: 603 WDIMSNGGPVQSIANLAKGKDRGNAVTIQVSSSGC 637