BLASTX nr result
ID: Forsythia21_contig00043211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043211 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601357.1| Ubiquitin carboxyl-terminal hydrolase family... 58 2e-06 emb|CAN83044.1| hypothetical protein VITISV_012267 [Vitis vinifera] 58 2e-06 >ref|XP_003601357.1| Ubiquitin carboxyl-terminal hydrolase family protein [Medicago truncatula] Length = 1148 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 356 PYGWTRYAQFSLAIVNQIHSKYTIKKGIS*HYF 258 PYGW+RYAQFSLAIVNQIH+K+T++KG + H F Sbjct: 112 PYGWSRYAQFSLAIVNQIHNKFTVRKGNTQHQF 144 >emb|CAN83044.1| hypothetical protein VITISV_012267 [Vitis vinifera] Length = 154 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -3 Query: 356 PYGWTRYAQFSLAIVNQIHSKYTIKKGI 273 PYGW+RYAQFSLA+VNQIH+KYT++KGI Sbjct: 109 PYGWSRYAQFSLAVVNQIHNKYTVRKGI 136