BLASTX nr result
ID: Forsythia21_contig00043031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043031 (288 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007681443.1| hypothetical protein BAUCODRAFT_41959, parti... 60 6e-07 >ref|XP_007681443.1| hypothetical protein BAUCODRAFT_41959, partial [Baudoinia compniacensis UAMH 10762] gi|449295436|gb|EMC91458.1| hypothetical protein BAUCODRAFT_41959, partial [Baudoinia compniacensis UAMH 10762] Length = 124 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = -1 Query: 258 EPHTGGTYHWGRGGQGNMVTLGEDEHHKKKERSVSRGEAGHEKPSLIEKGKHALGLG 88 EP +G TYHWGRGG+GNM+TLG+ H K++ V +++EKGK LGLG Sbjct: 69 EPRSGSTYHWGRGGEGNMMTLGDGAH---KDKEVPGHNRRGSFQAVVEKGKGMLGLG 122