BLASTX nr result
ID: Forsythia21_contig00043019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00043019 (303 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_663201.1| hypothetical protein AN5597.2 [Aspergillus nidu... 71 3e-10 ref|XP_007734342.1| ubiquinol-cytochrome c reductase subunit 6 [... 70 4e-10 ref|XP_008079649.1| Non-heme 11 kDa protein of cytochrome bc1 co... 69 9e-10 dbj|GAA82930.1| ubiquinol-cytochrome c reductase complex 17 kd p... 69 9e-10 ref|XP_001401886.1| ubiquinol-cytochrome c reductase complex 17 ... 69 9e-10 gb|KMM64930.1| hypothetical protein CPAG_01282 [Coccidioides pos... 69 1e-09 dbj|GAO83437.1| cytochrome b-c1 complex subunit 6 [Neosartorya u... 69 1e-09 gb|KJK65332.1| Ubiquinol-cytochrome C reductase hinge protein [A... 69 1e-09 gb|KEY75829.1| ubiquinol cytochrome c reductase complex 17 kd pr... 69 1e-09 ref|XP_002374249.1| ubiquinol-cytochrome c reductase complex 17 ... 69 1e-09 ref|XP_751690.1| ubiquinol-cytochrome c reductase complex 17 kd ... 69 1e-09 ref|XP_007288993.1| ubiquinol-cytochrome c reductase complex sub... 69 1e-09 ref|XP_003065676.1| hypothetical protein CPC735_049010 [Coccidio... 69 1e-09 ref|XP_002584583.1| predicted protein [Uncinocarpus reesii 1704]... 69 1e-09 ref|XP_001266889.1| ubiquinol-cytochrome c reductase complex 17 ... 69 1e-09 ref|XP_001247790.1| ubiquinol-cytochrome c reductase subunit 6 [... 69 1e-09 gb|KIN04328.1| hypothetical protein OIDMADRAFT_18297 [Oidiodendr... 69 2e-09 gb|KIV83138.1| hypothetical protein PV11_05191 [Exophiala sideris] 68 2e-09 ref|XP_007726998.1| hypothetical protein A1O1_07942 [Capronia co... 68 2e-09 ref|XP_009161356.1| ubiquinol-cytochrome c reductase subunit 6 [... 68 2e-09 >ref|XP_663201.1| hypothetical protein AN5597.2 [Aspergillus nidulans FGSC A4] gi|40743050|gb|EAA62240.1| hypothetical protein AN5597.2 [Aspergillus nidulans FGSC A4] gi|259484941|tpe|CBF81592.1| TPA: ubiquinol-cytochrome c reductase complex 17 kd protein (AFU_orthologue; AFUA_4G11390) [Aspergillus nidulans FGSC A4] Length = 162 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D K P EDCVEEFFHLAHCA QCAAPKLW ALK Sbjct: 126 QEDADYKGPKEDCVEEFFHLAHCATQCAAPKLWKALK 162 >ref|XP_007734342.1| ubiquinol-cytochrome c reductase subunit 6 [Capronia epimyces CBS 606.96] gi|590007011|gb|EXJ82219.1| ubiquinol-cytochrome c reductase subunit 6 [Capronia epimyces CBS 606.96] Length = 140 Score = 70.5 bits (171), Expect = 4e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D+K P+EDCVEEFFHL HCA QCAAPKLW ALK Sbjct: 104 QEDPDHKGPHEDCVEEFFHLQHCATQCAAPKLWKALK 140 >ref|XP_008079649.1| Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [Glarea lozoyensis ATCC 20868] gi|361127934|gb|EHK99889.1| putative Cytochrome b-c1 complex subunit 6 [Glarea lozoyensis 74030] gi|512204209|gb|EPE33032.1| Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [Glarea lozoyensis ATCC 20868] Length = 166 Score = 69.3 bits (168), Expect = 9e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ++ D AP+EDCVEEFFHLAHCAN+CAAPK+WAALK Sbjct: 131 NNADKSAPHEDCVEEFFHLAHCANECAAPKVWAALK 166 >dbj|GAA82930.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus kawachii IFO 4308] Length = 166 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D K P EDCVEEFFHL HCA QCAAPKLW ALK Sbjct: 130 QEDPDYKGPKEDCVEEFFHLTHCATQCAAPKLWKALK 166 >ref|XP_001401886.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus niger CBS 513.88] gi|134074490|emb|CAK38784.1| unnamed protein product [Aspergillus niger] gi|350632351|gb|EHA20719.1| hypothetical protein ASPNIDRAFT_57369 [Aspergillus niger ATCC 1015] Length = 167 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D K P EDCVEEFFHL HCA QCAAPKLW ALK Sbjct: 131 QEDPDYKGPKEDCVEEFFHLTHCATQCAAPKLWKALK 167 >gb|KMM64930.1| hypothetical protein CPAG_01282 [Coccidioides posadasii RMSCC 3488] Length = 132 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 +D D K P+EDCVEEFFHL HCA QCAAPKLWAALK Sbjct: 97 EDPDFKGPHEDCVEEFFHLQHCATQCAAPKLWAALK 132 >dbj|GAO83437.1| cytochrome b-c1 complex subunit 6 [Neosartorya udagawae] Length = 203 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ++D D+K P EDCVEEFFHLAHCA CAAPKLW ALK Sbjct: 167 EEDPDHKGPKEDCVEEFFHLAHCATNCAAPKLWKALK 203 >gb|KJK65332.1| Ubiquinol-cytochrome C reductase hinge protein [Aspergillus parasiticus SU-1] Length = 168 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D K P EDCVEEFFHLAHCA++CAAPKLW +LK Sbjct: 132 QEDADYKGPKEDCVEEFFHLAHCASECAAPKLWKSLK 168 >gb|KEY75829.1| ubiquinol cytochrome c reductase complex 17 kd protein [Aspergillus fumigatus var. RP-2014] Length = 158 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ++D D+K P EDCVEEFFHLAHCA CAAPKLW ALK Sbjct: 122 EEDPDHKGPKEDCVEEFFHLAHCATNCAAPKLWKALK 158 >ref|XP_002374249.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus flavus NRRL3357] gi|317144526|ref|XP_001820182.2| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus oryzae RIB40] gi|220699128|gb|EED55467.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus flavus NRRL3357] gi|391871624|gb|EIT80781.1| hypothetical protein Ao3042_02695 [Aspergillus oryzae 3.042] gi|635507186|gb|KDE79202.1| hypothetical protein AO1008_05581 [Aspergillus oryzae 100-8] gi|768704754|gb|KJJ31585.1| Ubiquinol-cytochrome C reductase hinge protein [Aspergillus flavus AF70] Length = 162 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D K P EDCVEEFFHLAHCA++CAAPKLW +LK Sbjct: 126 QEDADYKGPKEDCVEEFFHLAHCASECAAPKLWKSLK 162 >ref|XP_751690.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus fumigatus Af293] gi|66849324|gb|EAL89652.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus fumigatus Af293] gi|159125388|gb|EDP50505.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Aspergillus fumigatus A1163] gi|846908892|gb|KMK54857.1| ubiquinol-cytochrome c reductase complex protein [Aspergillus fumigatus Z5] Length = 158 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ++D D+K P EDCVEEFFHLAHCA CAAPKLW ALK Sbjct: 122 EEDPDHKGPKEDCVEEFFHLAHCATNCAAPKLWKALK 158 >ref|XP_007288993.1| ubiquinol-cytochrome c reductase complex subunit [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867384|gb|EKD20422.1| ubiquinol-cytochrome c reductase complex subunit [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 135 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 292 EDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ED K P+EDCVEEFFHLAHCA CAAPKLWAALK Sbjct: 102 EDKKQPDEDCVEEFFHLAHCATSCAAPKLWAALK 135 >ref|XP_003065676.1| hypothetical protein CPC735_049010 [Coccidioides posadasii C735 delta SOWgp] gi|240105338|gb|EER23531.1| hypothetical protein CPC735_049010 [Coccidioides posadasii C735 delta SOWgp] Length = 512 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 +D D K P+EDCVEEFFHL HCA QCAAPKLWAALK Sbjct: 477 EDPDFKGPHEDCVEEFFHLQHCATQCAAPKLWAALK 512 >ref|XP_002584583.1| predicted protein [Uncinocarpus reesii 1704] gi|237906029|gb|EEP80430.1| predicted protein [Uncinocarpus reesii 1704] Length = 133 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 +D D K P+EDCVEEFFHL HCA QCAAPKLWAALK Sbjct: 98 EDPDFKGPHEDCVEEFFHLQHCATQCAAPKLWAALK 133 >ref|XP_001266889.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Neosartorya fischeri NRRL 181] gi|119415054|gb|EAW24992.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Neosartorya fischeri NRRL 181] Length = 161 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 ++D D+K P EDCVEEFFHLAHCA CAAPKLW ALK Sbjct: 125 EEDPDHKGPKEDCVEEFFHLAHCATNCAAPKLWKALK 161 >ref|XP_001247790.1| ubiquinol-cytochrome c reductase subunit 6 [Coccidioides immitis RS] gi|90306576|gb|EAS36207.1| ubiquinol-cytochrome c reductase subunit 6 [Coccidioides immitis RS] gi|320039519|gb|EFW21453.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|859406259|gb|KMP01534.1| hypothetical protein CIRG_01673 [Coccidioides immitis RMSCC 2394] gi|875282762|gb|KMU76489.1| hypothetical protein CISG_01222 [Coccidioides immitis RMSCC 3703] gi|875643192|gb|KMU87526.1| hypothetical protein CIHG_05919 [Coccidioides immitis H538.4] Length = 132 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 +D D K P+EDCVEEFFHL HCA QCAAPKLWAALK Sbjct: 97 EDPDFKGPHEDCVEEFFHLQHCATQCAAPKLWAALK 132 >gb|KIN04328.1| hypothetical protein OIDMADRAFT_18297 [Oidiodendron maius Zn] Length = 138 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 283 KAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 K PNEDCVEEFFHLAHCA+QCAAPKLWAALK Sbjct: 108 KHPNEDCVEEFFHLAHCASQCAAPKLWAALK 138 >gb|KIV83138.1| hypothetical protein PV11_05191 [Exophiala sideris] Length = 155 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 298 DDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 +D D+K P EDCVEEFFHL HCA QCAAPKLW ALK Sbjct: 120 EDPDHKGPKEDCVEEFFHLQHCATQCAAPKLWKALK 155 >ref|XP_007726998.1| hypothetical protein A1O1_07942 [Capronia coronata CBS 617.96] gi|590006668|gb|EXJ81877.1| hypothetical protein A1O1_07942 [Capronia coronata CBS 617.96] Length = 136 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D+K P EDCVEEFFHL HCA QCAAPKLW LK Sbjct: 100 QEDPDHKGPKEDCVEEFFHLQHCATQCAAPKLWKQLK 136 >ref|XP_009161356.1| ubiquinol-cytochrome c reductase subunit 6 [Exophiala dermatitidis NIH/UT8656] gi|378734436|gb|EHY60895.1| ubiquinol-cytochrome c reductase subunit 6 [Exophiala dermatitidis NIH/UT8656] Length = 141 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 301 QDDEDNKAPNEDCVEEFFHLAHCANQCAAPKLWAALK 191 Q+D D+K P EDCVEEFFHL HCA QCAAPKLW LK Sbjct: 105 QEDPDHKGPKEDCVEEFFHLQHCATQCAAPKLWKQLK 141