BLASTX nr result
ID: Forsythia21_contig00042448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042448 (352 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084912.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore... 57 5e-06 >ref|XP_011084912.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein NUP88 [Sesamum indicum] Length = 811 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 351 RAVQLHNSLEERLHNLKSLSVLHKKPLSNAEQDFKPELGN 232 RAV++H+SLEERL NL+SL HKKPLS AE+DFK EL N Sbjct: 687 RAVKVHSSLEERLQNLRSLPGSHKKPLSKAERDFKLELDN 726