BLASTX nr result
ID: Forsythia21_contig00042332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042332 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ86296.1| AAA ATPase [Aureobasidium pullulans EXF-150] 69 1e-09 gb|KEQ98341.1| hypothetical protein AUEXF2481DRAFT_2298 [Aureoba... 68 2e-09 gb|KEQ59125.1| AAA ATPase [Aureobasidium melanogenum CBS 110374] 66 8e-09 gb|KEQ75102.1| AAA ATPase [Aureobasidium namibiae CBS 147.97] 65 1e-08 >gb|KEQ86296.1| AAA ATPase [Aureobasidium pullulans EXF-150] Length = 823 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 133 MSGEPDHVNTKDKVKPSLHDASGKEVQHVENDVSTAILKKKKKP 2 MSGEPDHV TK+KVK HD SG E +HVENDVSTAILKKKKKP Sbjct: 1 MSGEPDHVETKNKVKLE-HDPSGAEQKHVENDVSTAILKKKKKP 43 >gb|KEQ98341.1| hypothetical protein AUEXF2481DRAFT_2298 [Aureobasidium subglaciale EXF-2481] Length = 823 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = -1 Query: 133 MSGEPDHVNTKDKVKPSLHDASGKEVQHVENDVSTAILKKKKKP 2 MSGEPDHV TK KVK HD SG E +HVENDVSTAILKKKKKP Sbjct: 1 MSGEPDHVETKAKVKLE-HDTSGAEQKHVENDVSTAILKKKKKP 43 >gb|KEQ59125.1| AAA ATPase [Aureobasidium melanogenum CBS 110374] Length = 823 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 133 MSGEPDHVNTKDKVKPSLHDASGKEVQHVENDVSTAILKKKKKP 2 MSGEPDHV TK+KVK HD SG E ++VENDVSTAILKKKKKP Sbjct: 1 MSGEPDHVETKNKVKLE-HDPSGAEQKNVENDVSTAILKKKKKP 43 >gb|KEQ75102.1| AAA ATPase [Aureobasidium namibiae CBS 147.97] Length = 823 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -1 Query: 133 MSGEPDHVNTKDKVKPSLHDASGKEVQHVENDVSTAILKKKKKP 2 MSGEPDHV TK+KVK D SG E +HVENDVSTAILKKKKKP Sbjct: 1 MSGEPDHVETKNKVKLEA-DPSGAEQKHVENDVSTAILKKKKKP 43