BLASTX nr result
ID: Forsythia21_contig00042284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042284 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ63888.1| 60S ribosomal protein-like protein L39 [Aureobasi... 69 9e-10 ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptos... 69 2e-09 ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaer... 69 2e-09 dbj|GAO13893.1| hypothetical protein UVI_009110 [Ustilaginoidea ... 68 3e-09 gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus... 67 5e-09 gb|KFY64732.1| hypothetical protein V496_03067 [Pseudogymnoascus... 67 5e-09 ref|XP_008717114.1| 60S ribosomal protein L39 [Cyphellophora eur... 67 5e-09 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 67 5e-09 ref|XP_007926934.1| hypothetical protein MYCFIDRAFT_30141, parti... 67 5e-09 gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistro... 67 5e-09 gb|EHL00026.1| putative 60S ribosomal protein L39 [Glarea lozoye... 67 5e-09 ref|XP_011128210.1| hypothetical protein AOL_s00215g706 [Arthrob... 67 5e-09 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 67 5e-09 emb|CEF83650.1| unnamed protein product [Fusarium graminearum] 67 6e-09 emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 67 6e-09 gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxys... 67 6e-09 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 67 6e-09 emb|CEJ54809.1| Putative 60s ribosomal protein l39 [Penicillium ... 66 8e-09 gb|KJR85651.1| large subunit ribosomal protein L39e [Sporothrix ... 66 8e-09 gb|KFX44402.1| 60S ribosomal protein L39, partial [Talaromyces m... 66 8e-09 >gb|KEQ63888.1| 60S ribosomal protein-like protein L39 [Aureobasidium melanogenum CBS 110374] gi|662517991|gb|KEQ75552.1| 60S ribosomal protein-like protein L39 [Aureobasidium namibiae CBS 147.97] gi|662523116|gb|KEQ80511.1| 60S ribosomal protein-like protein L39 [Aureobasidium pullulans EXF-150] gi|662538824|gb|KEQ96129.1| hypothetical protein AUEXF2481DRAFT_4380 [Aureobasidium subglaciale EXF-2481] Length = 51 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] gi|312221210|emb|CBY01151.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] Length = 51 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRTNNTIRYNAKRRHWRKTR+GI Sbjct: 22 PIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 51 >ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] gi|160702486|gb|EAT83478.2| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] Length = 95 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRTNNTIRYNAKRRHWRKTR+GI Sbjct: 66 PIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 95 >dbj|GAO13893.1| hypothetical protein UVI_009110 [Ustilaginoidea virens] Length = 51 Score = 67.8 bits (164), Expect = 3e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 P+PQWIRLRTNNT+RYNAKRRHWRKTR+GI Sbjct: 22 PVPQWIRLRTNNTVRYNAKRRHWRKTRLGI 51 >gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus pannorum VKM F-103] Length = 89 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 60 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 89 >gb|KFY64732.1| hypothetical protein V496_03067 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] Length = 126 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 97 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 126 >ref|XP_008717114.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] gi|568117655|gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] Length = 72 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 43 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 72 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_007926934.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] gi|452982335|gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] Length = 49 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 20 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EHL00026.1| putative 60S ribosomal protein L39 [Glarea lozoyensis 74030] Length = 51 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_011128210.1| hypothetical protein AOL_s00215g706 [Arthrobotrys oligospora ATCC 24927] gi|345559967|gb|EGX43097.1| hypothetical protein AOL_s00215g706 [Arthrobotrys oligospora ATCC 24927] gi|582957408|gb|EWC45625.1| 60S ribosomal protein L39 [Drechslerella stenobrocha 248] Length = 51 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|667834302|ref|XP_007781320.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|751758072|gb|KIN06246.1| hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] gi|752278391|dbj|GAM86723.1| hypothetical protein ANO11243_047420 [fungal sp. No.11243] gi|796708356|gb|KJX99510.1| 60S ribosomal protein L39 [Zymoseptoria brevis] Length = 51 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CEF83650.1| unnamed protein product [Fusarium graminearum] Length = 68 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 P+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 39 PVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 68 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 P+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 64 PVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 4] gi|477512034|gb|ENH64595.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 1] Length = 49 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 P+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 20 PVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|685872197|ref|XP_009263131.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|758208834|ref|XP_011326588.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] gi|829113621|gb|KLO90055.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829136452|gb|KLP09859.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829151008|gb|KLP19369.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] Length = 51 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 P+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 22 PVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CEJ54809.1| Putative 60s ribosomal protein l39 [Penicillium brasilianum] Length = 92 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 63 PIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 92 >gb|KJR85651.1| large subunit ribosomal protein L39e [Sporothrix schenckii 1099-18] Length = 51 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 22 PIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|KFX44402.1| 60S ribosomal protein L39, partial [Talaromyces marneffei PM1] Length = 64 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 323 PIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 234 PIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 35 PIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 64