BLASTX nr result
ID: Forsythia21_contig00042081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042081 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084872.1| PREDICTED: probable apyrase 7 [Sesamum indicum] 67 5e-09 ref|XP_012830003.1| PREDICTED: probable apyrase 7 [Erythranthe g... 60 4e-07 >ref|XP_011084872.1| PREDICTED: probable apyrase 7 [Sesamum indicum] Length = 769 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -3 Query: 153 MFSKFSEIVSSIATRLSAPNNSFLSYKSPGLPSLRGSPLGYTFSSSEKEAN 1 + SKF+E +SS ATRLSAP S LSYKSPGLP L GS GYTFS EK+ N Sbjct: 2 VLSKFAEFLSSAATRLSAPKTSNLSYKSPGLPPLSGSLHGYTFSGPEKKTN 52 >ref|XP_012830003.1| PREDICTED: probable apyrase 7 [Erythranthe guttatus] gi|604344722|gb|EYU43437.1| hypothetical protein MIMGU_mgv1a001715mg [Erythranthe guttata] Length = 769 Score = 60.5 bits (145), Expect = 4e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -3 Query: 153 MFSKFSEIVSSIATRLSAPNNSFLSYKSPGLPSLRGS-PLGYTFSSSEKEAN 1 +FSKF+E VSS ATR SAP S SYKSPGLP L GS GYT+SS +K N Sbjct: 2 VFSKFAEFVSSAATRFSAPKASNTSYKSPGLPPLPGSVNNGYTYSSPDKNTN 53