BLASTX nr result
ID: Forsythia21_contig00041878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041878 (337 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB60706.1| hypothetical protein B456_009G321000 [Gossypium r... 74 3e-11 gb|KMS97977.1| hypothetical protein BVRB_4g096970 [Beta vulgaris... 71 2e-10 >gb|KJB60706.1| hypothetical protein B456_009G321000 [Gossypium raimondii] Length = 75 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/61 (63%), Positives = 44/61 (72%) Frame = -3 Query: 275 YNPRKNEGFEWNRTNDVEPRAPSFLYKYKIADVKIHNGSVLQVARCFLPHRFKRSFTITF 96 YNP+K ++NRT DVE +APSFLY K + VLQVARCFLPHRFKRSFTITF Sbjct: 17 YNPKKKT--DYNRTKDVEQKAPSFLYNGKWWVLTSTADHVLQVARCFLPHRFKRSFTITF 74 Query: 95 L 93 L Sbjct: 75 L 75 >gb|KMS97977.1| hypothetical protein BVRB_4g096970 [Beta vulgaris subsp. vulgaris] Length = 50 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 159 CPSSRTLLSTTSFQTKFYHNIPLIWNRYGIDSIMES 52 CP SRTLLSTTSFQTKFYHNIP WN+YG+DSIMES Sbjct: 15 CPLSRTLLSTTSFQTKFYHNIPQFWNQYGVDSIMES 50