BLASTX nr result
ID: Forsythia21_contig00041692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041692 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007676310.1| hypothetical protein BAUCODRAFT_70359 [Baudo... 62 1e-07 >ref|XP_007676310.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] gi|449300482|gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] Length = 305 Score = 62.0 bits (149), Expect = 1e-07 Identities = 37/80 (46%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = -2 Query: 250 DVRPSHDTAYTGSTVAAP-TSTYVKKEVEPMPAGGVLSEAHGNHAPHVGWSPHNDQPAPH 74 D RPSH+T YTGSTVAAP T++Y K +AH H PH H Sbjct: 239 DTRPSHETGYTGSTVAAPGTASYDK------------VDAHHGHQPH----------GTH 276 Query: 73 GNYYGTPQ-NAVNPYGYDNT 17 G YY PQ VNPYGYDN+ Sbjct: 277 GGYYTQPQGTGVNPYGYDNS 296