BLASTX nr result
ID: Forsythia21_contig00041660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041660 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY27960.1| hypothetical protein UCRPC4_g00805 [Phaeomoniella... 65 1e-08 >gb|KKY27960.1| hypothetical protein UCRPC4_g00805 [Phaeomoniella chlamydospora] Length = 204 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -3 Query: 173 MRSTIISLATMAGLAAAQF-PTTCTVSTVTF-GGALATITQTFTSTYCPVCPSVVTTY 6 MRS I+ LA +AG A AQ +TC V T T GGA++T+TQT+TSTYCP C V TTY Sbjct: 1 MRSAIVVLAALAGAAFAQLNSSTCIVPTSTLSGGAMSTVTQTYTSTYCPKCAEVTTTY 58