BLASTX nr result
ID: Forsythia21_contig00041636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041636 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005139580.2| PREDICTED: actin, cytoplasmic 1-like [Melops... 140 4e-31 ref|XP_006926969.1| PREDICTED: LOW QUALITY PROTEIN: actin, gamma... 140 4e-31 ref|XP_006859929.1| PREDICTED: actin, cytoplasmic 1 [Chrysochlor... 140 4e-31 ref|XP_006886217.1| PREDICTED: actin, cytoplasmic 2 [Elephantulu... 140 4e-31 ref|XP_006752408.1| PREDICTED: LOW QUALITY PROTEIN: actin, gamma... 140 4e-31 ref|XP_006753072.1| PREDICTED: actin, cytoplasmic 2 [Myotis davi... 140 4e-31 pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans ... 140 4e-31 ref|XP_001898433.1| actin 2 [Brugia malayi] gi|231498|sp|P30163.... 140 4e-31 sp|Q93129.1|ACTC_BRABE RecName: Full=Actin, cytoplasmic; AltName... 140 4e-31 ref|NP_001082422.1| actin, cytoplasmic 1 [Xenopus laevis] gi|410... 140 4e-31 sp|P18603.1|ACT4_ARTSX RecName: Full=Actin, clone 403; Flags: Pr... 140 4e-31 sp|P53486.1|ACTB3_TAKRU RecName: Full=Actin, cytoplasmic 3; AltN... 140 4e-31 dbj|BAB41207.1| cytoplasmic actin [Lethenteron camtschaticum] gi... 140 4e-31 ref|NP_505817.1| ACT-3 [Caenorhabditis elegans] gi|17563822|ref|... 140 4e-31 ref|NP_001007825.1| actin, cytoplasmic type 5 [Gallus gallus] gi... 140 4e-31 prf||1101351C actin 140 4e-31 gb|AAG16253.1|AF300705_1 beta-actin [Litopenaeus vannamei] gi|13... 140 4e-31 ref|NP_001095153.1| actin, cytoplasmic 1 [Oryctolagus cuniculus]... 140 4e-31 ref|NP_505818.1| ACT-2 [Caenorhabditis elegans] gi|268556882|ref... 140 4e-31 ref|XP_005031740.2| PREDICTED: actin, cytoplasmic 1 [Anas platyr... 140 4e-31 >ref|XP_005139580.2| PREDICTED: actin, cytoplasmic 1-like [Melopsittacus undulatus] Length = 257 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 190 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 249 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 250 SIVHRKCF 257 >ref|XP_006926969.1| PREDICTED: LOW QUALITY PROTEIN: actin, gamma 1 [Pteropus alecto] Length = 393 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >ref|XP_006859929.1| PREDICTED: actin, cytoplasmic 1 [Chrysochloris asiatica] Length = 352 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 285 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 344 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 345 SIVHRKCF 352 >ref|XP_006886217.1| PREDICTED: actin, cytoplasmic 2 [Elephantulus edwardii] Length = 299 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 232 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 291 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 292 SIVHRKCF 299 >ref|XP_006752408.1| PREDICTED: LOW QUALITY PROTEIN: actin, gamma 1 [Leptonychotes weddellii] Length = 411 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >ref|XP_006753072.1| PREDICTED: actin, cytoplasmic 2 [Myotis davidii] Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >ref|XP_001898433.1| actin 2 [Brugia malayi] gi|231498|sp|P30163.1|ACT2_ONCVO RecName: Full=Actin-2; Flags: Precursor [Onchocerca volvulus] gi|159871|gb|AAA29410.1| actin 2 [Onchocerca volvulus] gi|671414029|emb|CDP93364.1| Protein Bm9238, isoform a [Brugia malayi] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >sp|Q93129.1|ACTC_BRABE RecName: Full=Actin, cytoplasmic; AltName: Full=BbCA1; Contains: RecName: Full=Actin, cytoplasmic, N-terminally processed [Branchiostoma belcheri] gi|1552218|dbj|BAA13444.1| cytoplasmic actin BbCA1 [Branchiostoma belcheri] Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >ref|NP_001082422.1| actin, cytoplasmic 1 [Xenopus laevis] gi|41016788|sp|O93400.1|ACTB_XENLA RecName: Full=Actin, cytoplasmic 1; AltName: Full=Beta-actin; AltName: Full=Cytoplasmic beta-actin; Contains: RecName: Full=Actin, cytoplasmic 1, N-terminally processed gi|3348131|gb|AAC27796.1| cytoplasmic beta actin [Xenopus laevis] gi|27735427|gb|AAH41203.1| MGC52661 protein [Xenopus laevis] gi|54035188|gb|AAH84121.1| MGC52661 protein [Xenopus laevis] Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >sp|P18603.1|ACT4_ARTSX RecName: Full=Actin, clone 403; Flags: Precursor [Artemia sp.] gi|5668|emb|CAA36838.1| unnamed protein product [Artemia sp.] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >sp|P53486.1|ACTB3_TAKRU RecName: Full=Actin, cytoplasmic 3; AltName: Full=Beta-actin C; Contains: RecName: Full=Actin, cytoplasmic 3, N-terminally processed gi|1335825|gb|AAC59891.1| beta-cytoplasmic(vascular) actin [Takifugu rubripes] Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >dbj|BAB41207.1| cytoplasmic actin [Lethenteron camtschaticum] gi|752631089|gb|AJG41731.1| beta-actin [Petromyzon marinus] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >ref|NP_505817.1| ACT-3 [Caenorhabditis elegans] gi|17563822|ref|NP_505819.1| ACT-1 [Caenorhabditis elegans] gi|308476478|ref|XP_003100455.1| hypothetical protein CRE_18060 [Caenorhabditis remanei] gi|519881597|sp|P0DM41.1|ACT1_CAEEL RecName: Full=Actin-1; Flags: Precursor gi|519881599|sp|P0DM42.1|ACT3_CAEEL RecName: Full=Actin-3; Flags: Precursor gi|6624|emb|CAA34717.1| actin [Caenorhabditis elegans] gi|3879475|emb|CAB04676.1| ACT-3 [Caenorhabditis elegans] gi|3879477|emb|CAB04678.1| ACT-1 [Caenorhabditis elegans] gi|308264990|gb|EFP08943.1| hypothetical protein CRE_18060 [Caenorhabditis remanei] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >ref|NP_001007825.1| actin, cytoplasmic type 5 [Gallus gallus] gi|326926370|ref|XP_003209375.1| PREDICTED: actin, cytoplasmic type 5 [Meleagris gallopavo] gi|529439405|ref|XP_005239451.1| PREDICTED: actin, cytoplasmic type 5-like isoform X1 [Falco peregrinus] gi|541965006|ref|XP_005437512.1| PREDICTED: actin, cytoplasmic type 5-like isoform X1 [Falco cherrug] gi|558184754|ref|XP_006128091.1| PREDICTED: actin, cytoplasmic type 5-like [Pelodiscus sinensis] gi|694853046|ref|XP_009467921.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Nipponia nippon] gi|695140376|ref|XP_009512649.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Phalacrocorax carbo] gi|697024531|ref|XP_009573992.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Fulmarus glacialis] gi|697505172|ref|XP_009680943.1| PREDICTED: actin, cytoplasmic type 5 [Struthio camelus australis] gi|697843686|ref|XP_009642204.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Egretta garzetta] gi|699601856|ref|XP_009870298.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Apaloderma vittatum] gi|700356179|ref|XP_009922437.1| PREDICTED: actin, cytoplasmic type 5 [Haliaeetus albicilla] gi|700409000|ref|XP_009956530.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Leptosomus discolor] gi|701315574|ref|XP_009979092.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Tauraco erythrolophus] gi|704230417|ref|XP_010146290.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Eurypyga helias] gi|704298024|ref|XP_010161954.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Caprimulgus carolinensis] gi|704464587|ref|XP_010085288.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Pterocles gutturalis] gi|719788115|ref|XP_010223399.1| PREDICTED: actin, cytoplasmic type 5 [Tinamus guttatus] gi|723134497|ref|XP_010283823.1| PREDICTED: actin, cytoplasmic 2 isoform X1 [Phaethon lepturus] gi|723548303|ref|XP_010297260.1| PREDICTED: actin, cytoplasmic type 5 isoform X1 [Balearica regulorum gibbericeps] gi|729746862|ref|XP_010569907.1| PREDICTED: actin, cytoplasmic type 5 [Haliaeetus leucocephalus] gi|768341895|ref|XP_011588368.1| PREDICTED: actin, cytoplasmic type 5 [Aquila chrysaetos canadensis] gi|1703121|sp|P53478.1|ACT5_CHICK RecName: Full=Actin, cytoplasmic type 5 gi|63007|emb|CAA26486.1| unnamed protein product [Gallus gallus] gi|676245311|gb|KFO09183.1| Actin, cytoplasmic type 5 [Balearica regulorum gibbericeps] gi|676826466|gb|KFP20066.1| Actin, cytoplasmic type 5 [Egretta garzetta] gi|677194555|gb|KFP46255.1| Actin, cytoplasmic type 5 [Cathartes aura] gi|677294891|gb|KFP77319.1| Actin, cytoplasmic type 5 [Apaloderma vittatum] gi|677366079|gb|KFP94876.1| Actin, cytoplasmic type 5 [Haliaeetus albicilla] gi|677380880|gb|KFQ03765.1| Actin, cytoplasmic type 5 [Leptosomus discolor] gi|677484094|gb|KFQ73499.1| Actin, cytoplasmic type 5 [Phaethon lepturus] gi|677540525|gb|KFR02067.1| Actin, cytoplasmic type 5 [Nipponia nippon] gi|678128107|gb|KFU97295.1| Actin, cytoplasmic type 5 [Pterocles gutturalis] gi|678135327|gb|KFV04509.1| Actin, cytoplasmic type 5 [Tauraco erythrolophus] gi|678218290|gb|KFV85269.1| Actin, cytoplasmic type 5 [Struthio camelus australis] gi|678976193|gb|KFV89895.1| Actin, cytoplasmic type 5 [Eurypyga helias] gi|678978683|gb|KFV91387.1| Actin, cytoplasmic type 5 [Fulmarus glacialis] gi|679193231|gb|KFW83229.1| Actin, cytoplasmic type 5 [Phalacrocorax carbo] gi|683447590|gb|KFZ46276.1| Actin, cytoplasmic type 5 [Caprimulgus carolinensis] gi|683459641|gb|KFZ54536.1| Actin, cytoplasmic type 5 [Podiceps cristatus] gi|697423463|gb|KGL84463.1| Actin, cytoplasmic type 5 [Tinamus guttatus] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >prf||1101351C actin Length = 374 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 307 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 366 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 367 SIVHRKCF 374 >gb|AAG16253.1|AF300705_1 beta-actin [Litopenaeus vannamei] gi|13647003|dbj|BAB41102.1| actin [Marsupenaeus japonicus] gi|34576243|emb|CAE46725.1| beta actin [Homarus gammarus] gi|51472040|gb|AAU04441.1| beta-actin [Macrobrachium rosenbergii] gi|68138000|gb|AAY85815.1| beta-actin [Callinectes sapidus] gi|77955978|gb|ABB05541.1| beta actin [Fenneropenaeus chinensis] gi|295849226|gb|ADG45301.1| actin [Marsupenaeus japonicus] gi|295849230|gb|ADG45303.1| actin [Marsupenaeus japonicus] gi|295849232|gb|ADG45304.1| actin [Marsupenaeus japonicus] gi|295849234|gb|ADG45305.1| actin [Marsupenaeus japonicus] gi|295849236|gb|ADG45306.1| actin [Marsupenaeus japonicus] gi|295849242|gb|ADG45309.1| actin [Marsupenaeus japonicus] gi|296933760|gb|ADH93990.1| actin [Marsupenaeus japonicus] gi|296933766|gb|ADH93993.1| actin [Marsupenaeus japonicus] gi|355336885|gb|AER57915.1| beta-actin [Penaeus monodon] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >ref|NP_001095153.1| actin, cytoplasmic 1 [Oryctolagus cuniculus] gi|231506|sp|P29751.1|ACTB_RABIT RecName: Full=Actin, cytoplasmic 1; AltName: Full=Beta-actin; Contains: RecName: Full=Actin, cytoplasmic 1, N-terminally processed gi|1703|emb|CAA43140.1| gamma non-muscle actin [Oryctolagus cuniculus] Length = 375 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 308 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 368 SIVHRKCF 375 >ref|NP_505818.1| ACT-2 [Caenorhabditis elegans] gi|268556882|ref|XP_002636430.1| Hypothetical protein CBG23091 [Caenorhabditis briggsae] gi|308476392|ref|XP_003100412.1| CRE-ACT-2 protein [Caenorhabditis remanei] gi|21264389|sp|P10984.3|ACT2_CAEEL RecName: Full=Actin-2; Flags: Precursor gi|3879474|emb|CAB04675.1| ACT-2 [Caenorhabditis elegans] gi|187021297|emb|CAP39879.1| Protein CBR-ACT-2 [Caenorhabditis briggsae] gi|308264947|gb|EFP08900.1| CRE-ACT-2 protein [Caenorhabditis remanei] gi|341899404|gb|EGT55339.1| hypothetical protein CAEBREN_14989 [Caenorhabditis brenneri] Length = 376 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 309 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 369 SIVHRKCF 376 >ref|XP_005031740.2| PREDICTED: actin, cytoplasmic 1 [Anas platyrhynchos] Length = 253 Score = 140 bits (352), Expect = 4e-31 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = -3 Query: 234 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 55 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP Sbjct: 186 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 245 Query: 54 SIVHRKCF 31 SIVHRKCF Sbjct: 246 SIVHRKCF 253