BLASTX nr result
ID: Forsythia21_contig00041635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041635 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007687079.1| hypothetical protein COCMIDRAFT_4532 [Bipola... 157 3e-36 gb|EMD97494.1| hypothetical protein COCHEDRAFT_1125087 [Bipolari... 157 3e-36 ref|XP_007696375.1| hypothetical protein COCSADRAFT_79107 [Bipol... 157 3e-36 ref|XP_003841873.1| similar to eukaryotic translation initiation... 156 4e-36 gb|KJX93031.1| eukaryotic translation initiation factor 3 subuni... 155 1e-35 ref|XP_008022808.1| hypothetical protein SETTUDRAFT_167639 [Seto... 155 1e-35 gb|EMF09078.1| eukaryotic translation initiation factor 3 subuni... 155 1e-35 ref|XP_003848495.1| hypothetical protein MYCGRDRAFT_63945 [Zymos... 155 1e-35 ref|XP_003305565.1| hypothetical protein PTT_18440 [Pyrenophora ... 155 1e-35 ref|XP_001933599.1| eukaryotic translation initiation factor 3 s... 155 1e-35 gb|EEH04833.1| eukaryotic translation initiation factor 3 subuni... 153 4e-35 gb|EER37177.1| eukaryotic translation initiation factor 3 subuni... 153 4e-35 ref|XP_001542998.1| conserved hypothetical protein [Histoplasma ... 153 4e-35 gb|KKZ62554.1| eukaryotic translation initiation factor 3 subuni... 153 5e-35 gb|EEH39762.2| eukaryotic translation initiation factor 3 subuni... 153 5e-35 ref|XP_010755910.1| eukaryotic translation initiation factor 3 s... 153 5e-35 gb|EEQ83954.1| eukaryotic translation initiation factor 3 subuni... 153 5e-35 ref|XP_002623456.1| eukaryotic translation initiation factor 3 s... 153 5e-35 ref|XP_002796063.1| eukaryotic translation initiation factor 3 s... 153 5e-35 sp|Q0U0X1.3|EIF3E_PHANO RecName: Full=Eukaryotic translation ini... 152 8e-35 >ref|XP_007687079.1| hypothetical protein COCMIDRAFT_4532 [Bipolaris oryzae ATCC 44560] gi|628198683|ref|XP_007710366.1| hypothetical protein COCCADRAFT_24723 [Bipolaris zeicola 26-R-13] gi|576921167|gb|EUC35312.1| hypothetical protein COCCADRAFT_24723 [Bipolaris zeicola 26-R-13] gi|576932830|gb|EUC46365.1| hypothetical protein COCMIDRAFT_4532 [Bipolaris oryzae ATCC 44560] gi|578486263|gb|EUN23741.1| hypothetical protein COCVIDRAFT_40631 [Bipolaris victoriae FI3] Length = 436 Score = 157 bits (396), Expect = 3e-36 Identities = 70/81 (86%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRETLTDM Sbjct: 185 EILSVNWDSAMEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSRETLTDM 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 245 FFSPAYINTIQTNCPWILRYL 265 >gb|EMD97494.1| hypothetical protein COCHEDRAFT_1125087 [Bipolaris maydis C5] gi|477584276|gb|ENI01369.1| hypothetical protein COCC4DRAFT_148182 [Bipolaris maydis ATCC 48331] Length = 436 Score = 157 bits (396), Expect = 3e-36 Identities = 70/81 (86%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRETLTDM Sbjct: 185 EILSVNWDSAMEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSRETLTDM 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 245 FFSPAYINTIQTNCPWILRYL 265 >ref|XP_007696375.1| hypothetical protein COCSADRAFT_79107 [Bipolaris sorokiniana ND90Pr] gi|451855590|gb|EMD68882.1| hypothetical protein COCSADRAFT_79107 [Bipolaris sorokiniana ND90Pr] Length = 436 Score = 157 bits (396), Expect = 3e-36 Identities = 70/81 (86%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRETLTDM Sbjct: 185 EILSVNWDSAMEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSRETLTDM 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 245 FFSPAYINTIQTNCPWILRYL 265 >ref|XP_003841873.1| similar to eukaryotic translation initiation factor 3 subunit E [Leptosphaeria maculans JN3] gi|312218448|emb|CBX98394.1| similar to eukaryotic translation initiation factor 3 subunit E [Leptosphaeria maculans JN3] Length = 438 Score = 156 bits (395), Expect = 4e-36 Identities = 70/81 (86%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRETLTDM Sbjct: 187 EILSVNWDSAIEEINKIKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSRETLTDM 246 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 247 FFSPAYINTIQTNCPWILRYL 267 >gb|KJX93031.1| eukaryotic translation initiation factor 3 subunit e like protein [Zymoseptoria brevis] Length = 441 Score = 155 bits (391), Expect = 1e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 DILT NWESA+EEV+K+KESIDTRLF+NPLAQLQHRTWL+HWSLFP FNHE +RE LT++ Sbjct: 185 DILTVNWESAMEEVMKIKESIDTRLFNNPLAQLQHRTWLLHWSLFPFFNHEPAREALTEL 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT+CPWILRYL Sbjct: 245 FFSPAYINTIQTSCPWILRYL 265 >ref|XP_008022808.1| hypothetical protein SETTUDRAFT_167639 [Setosphaeria turcica Et28A] gi|482813216|gb|EOA89920.1| hypothetical protein SETTUDRAFT_167639 [Setosphaeria turcica Et28A] Length = 436 Score = 155 bits (391), Expect = 1e-35 Identities = 69/81 (85%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRETLTDM Sbjct: 185 EILSVNWDSAMEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSRETLTDM 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT+CPWILRYL Sbjct: 245 FFSPAYINTIQTSCPWILRYL 265 >gb|EMF09078.1| eukaryotic translation initiation factor 3 subunit 6 [Sphaerulina musiva SO2202] Length = 440 Score = 155 bits (391), Expect = 1e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 DIL TNWESA+EEV+K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNHE +RE LT++ Sbjct: 184 DILNTNWESAMEEVMKIKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHEPAREQLTEL 243 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT+CPW+LRYL Sbjct: 244 FFSPAYINTIQTSCPWVLRYL 264 >ref|XP_003848495.1| hypothetical protein MYCGRDRAFT_63945 [Zymoseptoria tritici IPO323] gi|339468370|gb|EGP83471.1| hypothetical protein MYCGRDRAFT_63945 [Zymoseptoria tritici IPO323] Length = 441 Score = 155 bits (391), Expect = 1e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 DILT NWESA+EEV+K+KESIDTRLF+NPLAQLQHRTWL+HWSLFP FNHE +RE LT++ Sbjct: 185 DILTVNWESAMEEVMKIKESIDTRLFNNPLAQLQHRTWLLHWSLFPFFNHEPAREALTEL 244 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT+CPWILRYL Sbjct: 245 FFSPAYINTIQTSCPWILRYL 265 >ref|XP_003305565.1| hypothetical protein PTT_18440 [Pyrenophora teres f. teres 0-1] gi|311317363|gb|EFQ86340.1| hypothetical protein PTT_18440 [Pyrenophora teres f. teres 0-1] Length = 433 Score = 155 bits (391), Expect = 1e-35 Identities = 69/81 (85%), Positives = 76/81 (93%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRE LTDM Sbjct: 182 EILSVNWDSAMEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSREALTDM 241 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 242 FFSPAYINTIQTNCPWILRYL 262 >ref|XP_001933599.1| eukaryotic translation initiation factor 3 subunit E [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979163|gb|EDU45789.1| eukaryotic translation initiation factor 3 subunit E [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 433 Score = 155 bits (391), Expect = 1e-35 Identities = 69/81 (85%), Positives = 76/81 (93%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +IL+ NW+SA+EE+ K+KE IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE SRE LTDM Sbjct: 182 EILSVNWDSAIEEINKLKEIIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHETSREALTDM 241 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQTNCPWILRYL Sbjct: 242 FFSPAYINTIQTNCPWILRYL 262 >gb|EEH04833.1| eukaryotic translation initiation factor 3 subunit 6 [Histoplasma capsulatum G186AR] Length = 455 Score = 153 bits (387), Expect = 4e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >gb|EER37177.1| eukaryotic translation initiation factor 3 subunit 6 [Histoplasma capsulatum H143] gi|325087554|gb|EGC40864.1| eukaryotic translation initiation factor 3 subunit 6 [Histoplasma capsulatum H88] Length = 455 Score = 153 bits (387), Expect = 4e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >ref|XP_001542998.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|150406639|gb|EDN02180.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] Length = 455 Score = 153 bits (387), Expect = 4e-35 Identities = 68/81 (83%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >gb|KKZ62554.1| eukaryotic translation initiation factor 3 subunit E [Emmonsia crescens UAMH 3008] Length = 450 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPW+LRYL Sbjct: 263 FFSPAYINTIQTACPWVLRYL 283 >gb|EEH39762.2| eukaryotic translation initiation factor 3 subunit E [Paracoccidioides sp. 'lutzii' Pb01] Length = 450 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EE+ K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEIQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >ref|XP_010755910.1| eukaryotic translation initiation factor 3 subunit E [Paracoccidioides brasiliensis Pb18] gi|225681681|gb|EEH19965.1| eukaryotic translation initiation factor 3 subunit E [Paracoccidioides brasiliensis Pb03] gi|699752684|gb|EEH44337.2| eukaryotic translation initiation factor 3 subunit E [Paracoccidioides brasiliensis Pb18] Length = 450 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EE+ K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEIQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >gb|EEQ83954.1| eukaryotic translation initiation factor 3 subunit 6 [Blastomyces dermatitidis ER-3] gi|327354568|gb|EGE83425.1| eukaryotic translation initiation factor 3 subunit 6 [Blastomyces dermatitidis ATCC 18188] gi|531985695|gb|EQL36282.1| eukaryotic translation initiation factor 3 subunit E [Blastomyces dermatitidis ATCC 26199] Length = 455 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPW+LRYL Sbjct: 263 FFSPAYINTIQTACPWVLRYL 283 >ref|XP_002623456.1| eukaryotic translation initiation factor 3 subunit 6 [Blastomyces dermatitidis SLH14081] gi|239588470|gb|EEQ71113.1| eukaryotic translation initiation factor 3 subunit 6 [Blastomyces dermatitidis SLH14081] Length = 455 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EEV K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEVQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPW+LRYL Sbjct: 263 FFSPAYINTIQTACPWVLRYL 283 >ref|XP_002796063.1| eukaryotic translation initiation factor 3 subunit E [Paracoccidioides sp. 'lutzii' Pb01] Length = 455 Score = 153 bits (386), Expect = 5e-35 Identities = 67/81 (82%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 +ILTTNWE+A+EE+ K+KESIDTRLF+NPLAQLQHRTWLIHWSLFP FNH+ +R+TLTD+ Sbjct: 203 EILTTNWEAAMEEIQKVKESIDTRLFNNPLAQLQHRTWLIHWSLFPFFNHDPARDTLTDL 262 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSPAYINTIQT CPWILRYL Sbjct: 263 FFSPAYINTIQTACPWILRYL 283 >sp|Q0U0X1.3|EIF3E_PHANO RecName: Full=Eukaryotic translation initiation factor 3 subunit E; Short=eIF3e Length = 435 Score = 152 bits (384), Expect = 8e-35 Identities = 66/81 (81%), Positives = 77/81 (95%) Frame = -1 Query: 244 DILTTNWESALEEVLKMKESIDTRLFSNPLAQLQHRTWLIHWSLFPLFNHEASRETLTDM 65 + L+ NW+SA+EE+ K+KE+IDTRLF+NPLAQLQHRTWLIHWSLFPLFNHE +RE+LTDM Sbjct: 184 EFLSVNWDSAIEEINKLKETIDTRLFNNPLAQLQHRTWLIHWSLFPLFNHEPARESLTDM 243 Query: 64 FFSPAYINTIQTNCPWILRYL 2 FFSP+YINTIQTNCPWILRYL Sbjct: 244 FFSPSYINTIQTNCPWILRYL 264