BLASTX nr result
ID: Forsythia21_contig00041389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041389 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007694696.1| hypothetical protein COCSADRAFT_209102 [Bipo... 62 1e-07 >ref|XP_007694696.1| hypothetical protein COCSADRAFT_209102 [Bipolaris sorokiniana ND90Pr] gi|451856054|gb|EMD69345.1| hypothetical protein COCSADRAFT_209102 [Bipolaris sorokiniana ND90Pr] Length = 150 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/69 (50%), Positives = 39/69 (56%) Frame = -3 Query: 209 WIDIPSSLQVXXXXXXXXXXXXXXSRLPATRDAVCVCL*MSFHQMMRSVYISLSMSVPEV 30 WIDIPSS + + P CL +SFHQMMR V+ISLSMSVPEV Sbjct: 48 WIDIPSSRSLTVKLCRQLSLRQTYVQSPCLLRLHVRCLQISFHQMMRFVHISLSMSVPEV 107 Query: 29 PYARSSVPP 3 PYAR SV P Sbjct: 108 PYARFSVQP 116