BLASTX nr result
ID: Forsythia21_contig00041253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041253 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077276.1| PREDICTED: ATPase ASNA1 homolog 2-like [Sesa... 59 1e-06 >ref|XP_011077276.1| PREDICTED: ATPase ASNA1 homolog 2-like [Sesamum indicum] gi|747061604|ref|XP_011077277.1| PREDICTED: ATPase ASNA1 homolog 2-like [Sesamum indicum] Length = 410 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = -3 Query: 197 MAICSSSASTCIHSFSSSKPMAIVGSRCFYTHSLKSHVSPFWNFKPSFSSRLLSLSIARK 18 MA CSSSA+ F++ +PMAI+ + HSL+ H++PF FKPS S LLS+S+ RK Sbjct: 1 MASCSSSAAI----FTTLRPMAILSNNSRNFHSLRPHLAPFLKFKPSSKSSLLSISVVRK 56 Query: 17 KPR 9 PR Sbjct: 57 MPR 59