BLASTX nr result
ID: Forsythia21_contig00041194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041194 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ62152.1| trehalase-domain-containing protein [Aureobasidiu... 71 2e-10 gb|KEQ79054.1| trehalase-domain-containing protein [Aureobasidiu... 68 3e-09 gb|KEQ92603.1| glycoside hydrolase family 37 protein [Aureobasid... 66 8e-09 gb|KEQ76476.1| trehalase-domain-containing protein [Aureobasidiu... 64 4e-08 gb|EME46346.1| glycoside hydrolase family 37 protein [Dothistrom... 56 8e-06 >gb|KEQ62152.1| trehalase-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 785 Score = 71.2 bits (173), Expect = 2e-10 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%) Frame = -1 Query: 203 D*LAAQGSSGRHSMSLQSSQNGKGHLRKPS---EELDPYSAAHIYYGESHRKRDVGKART 33 D L+ + ++G+ + + SSQ H R+ S +LDPYSA+HIYYG SH KR+V KART Sbjct: 39 DSLSQKAATGKPAAAGASSQQLPMHPRRSSGAAPDLDPYSASHIYYGASHNKRNVAKART 98 Query: 32 YSAVDPAARA 3 YSAVDP ARA Sbjct: 99 YSAVDPGARA 108 >gb|KEQ79054.1| trehalase-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 784 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -1 Query: 185 GSSGRHSMSLQSSQNGKGHLRKPSEELDPYSAAHIYYGESHRKRDVGKARTYSAVDPAAR 6 GS+G + + + G + +LDPYSA+HIYYG SH KR+V KARTYSAVDP AR Sbjct: 50 GSTGSKELPIHPPRKSSG----AAADLDPYSASHIYYGASHNKRNVAKARTYSAVDPGAR 105 Query: 5 A 3 A Sbjct: 106 A 106 >gb|KEQ92603.1| glycoside hydrolase family 37 protein [Aureobasidium subglaciale EXF-2481] Length = 791 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 3/46 (6%) Frame = -1 Query: 131 HLRKPS---EELDPYSAAHIYYGESHRKRDVGKARTYSAVDPAARA 3 H RK S +LDPYSA+HIYYG SH KR+V KARTYSAVDP ARA Sbjct: 67 HPRKSSGAATDLDPYSASHIYYGASHNKRNVAKARTYSAVDPGARA 112 >gb|KEQ76476.1| trehalase-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 792 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -1 Query: 191 AQGSSGRHSMSLQSSQNGKGHLRKPSEELDPYSAAHIYYGESHRKRDVGKARTYSAVDPA 12 A SS + + ++ G + +LDPYSA+HIYYG SH KR+V KARTYSAVDP Sbjct: 57 ADASSQSKQLPIHPTRKSSG----AATDLDPYSASHIYYGASHNKRNVAKARTYSAVDPG 112 Query: 11 ARA 3 RA Sbjct: 113 IRA 115 >gb|EME46346.1| glycoside hydrolase family 37 protein [Dothistroma septosporum NZE10] Length = 804 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/61 (47%), Positives = 40/61 (65%) Frame = -1 Query: 197 LAAQGSSGRHSMSLQSSQNGKGHLRKPSEELDPYSAAHIYYGESHRKRDVGKARTYSAVD 18 +++Q S+ H S QNG+ +L S +LDPY+A +YYG SH R V K+RTYSA+D Sbjct: 1 MSSQQSALPHHTRKPSHQNGEQNL---SLDLDPYAAPSVYYGGSHSPRKVAKSRTYSAID 57 Query: 17 P 15 P Sbjct: 58 P 58