BLASTX nr result
ID: Forsythia21_contig00040913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040913 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012089896.1| PREDICTED: myb-related protein 330-like isof... 122 1e-25 ref|XP_011097098.1| PREDICTED: myb-related protein 308-like [Ses... 122 1e-25 ref|XP_011001250.1| PREDICTED: transcription repressor MYB6-like... 122 1e-25 ref|XP_012089895.1| PREDICTED: myb-related protein 308-like isof... 122 1e-25 ref|XP_002325733.1| hypothetical protein POPTR_0019s00750g [Popu... 122 1e-25 gb|KHN31220.1| Myb-related protein 308 [Glycine soja] 121 2e-25 gb|KHN09677.1| Myb-related protein 308 [Glycine soja] 121 2e-25 gb|KEH35662.1| myb transcription factor [Medicago truncatula] 121 2e-25 ref|XP_002513249.1| r2r3-myb transcription factor, putative [Ric... 121 2e-25 ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Cit... 121 2e-25 ref|XP_007137818.1| hypothetical protein PHAVU_009G158200g [Phas... 121 2e-25 ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citr... 121 2e-25 ref|NP_001242477.1| uncharacterized protein LOC100808083 [Glycin... 121 2e-25 ref|NP_001235662.1| MYB transcription factor MYB56 [Glycine max]... 121 2e-25 ref|XP_012844438.1| PREDICTED: transcription repressor MYB4-like... 120 3e-25 ref|XP_011007997.1| PREDICTED: myb-related protein 308-like [Pop... 120 5e-25 gb|ACU23165.1| unknown [Glycine max] 119 8e-25 ref|XP_010675151.1| PREDICTED: transcription repressor MYB6-like... 119 1e-24 ref|XP_006384381.1| hypothetical protein POPTR_0004s14510g [Popu... 119 1e-24 ref|XP_006659665.1| PREDICTED: myb-related protein Zm38-like [Or... 119 1e-24 >ref|XP_012089896.1| PREDICTED: myb-related protein 330-like isoform X2 [Jatropha curcas] Length = 204 Score = 122 bits (305), Expect = 1e-25 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLVNYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_011097098.1| PREDICTED: myb-related protein 308-like [Sesamum indicum] Length = 274 Score = 122 bits (305), Expect = 1e-25 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLV YIKQHGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVKYIKQHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_011001250.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica] gi|743942995|ref|XP_011015999.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica] Length = 318 Score = 122 bits (305), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_012089895.1| PREDICTED: myb-related protein 308-like isoform X1 [Jatropha curcas] gi|643706775|gb|KDP22699.1| hypothetical protein JCGZ_02792 [Jatropha curcas] gi|696739900|gb|AIT52252.1| MYB family protein [Jatropha curcas] Length = 307 Score = 122 bits (305), Expect = 1e-25 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLVNYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_002325733.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa] gi|222862608|gb|EEF00115.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa] Length = 318 Score = 122 bits (305), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCR 54 >gb|KHN31220.1| Myb-related protein 308 [Glycine soja] Length = 302 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >gb|KHN09677.1| Myb-related protein 308 [Glycine soja] Length = 301 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >gb|KEH35662.1| myb transcription factor [Medicago truncatula] Length = 297 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_002513249.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223547623|gb|EEF49117.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 269 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Citrus sinensis] Length = 315 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_007137818.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris] gi|561010905|gb|ESW09812.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris] Length = 318 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citrus clementina] gi|557528408|gb|ESR39658.1| hypothetical protein CICLE_v10026112mg [Citrus clementina] gi|641839805|gb|KDO58731.1| hypothetical protein CISIN_1g021220mg [Citrus sinensis] Length = 316 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|NP_001242477.1| uncharacterized protein LOC100808083 [Glycine max] gi|255642080|gb|ACU21306.1| unknown [Glycine max] Length = 303 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|NP_001235662.1| MYB transcription factor MYB56 [Glycine max] gi|110931656|gb|ABH02827.1| MYB transcription factor MYB56 [Glycine max] Length = 300 Score = 121 bits (303), Expect = 2e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_012844438.1| PREDICTED: transcription repressor MYB4-like [Erythranthe guttatus] gi|604320669|gb|EYU31566.1| hypothetical protein MIMGU_mgv1a013684mg [Erythranthe guttata] Length = 213 Score = 120 bits (301), Expect = 3e-25 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERL++Y+KQHGEGCWRSLPK+AGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLISYVKQHGEGCWRSLPKSAGLLRCGKSCR 54 >ref|XP_011007997.1| PREDICTED: myb-related protein 308-like [Populus euphratica] Length = 309 Score = 120 bits (300), Expect = 5e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLV+YIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVSYIKAHGEGCWRSLPKAAGLLRCGKSCR 54 >gb|ACU23165.1| unknown [Glycine max] Length = 302 Score = 119 bits (298), Expect = 8e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEH NKGAWTKEEDERL+NYIK HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHANKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_010675151.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. vulgaris] gi|870862148|gb|KMT13371.1| hypothetical protein BVRB_4g084080 [Beta vulgaris subsp. vulgaris] Length = 322 Score = 119 bits (297), Expect = 1e-24 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEED+RLVNYIK HGEGCWRSLPKAAGL RCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDDRLVNYIKSHGEGCWRSLPKAAGLQRCGKSCR 54 >ref|XP_006384381.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa] gi|550340997|gb|ERP62178.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa] Length = 319 Score = 119 bits (297), Expect = 1e-24 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLVNYIK GEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAQGEGCWRSLPKAAGLLRCGKSCR 54 >ref|XP_006659665.1| PREDICTED: myb-related protein Zm38-like [Oryza brachyantha] Length = 247 Score = 119 bits (297), Expect = 1e-24 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = +1 Query: 160 MGRSPCCEKEHTNKGAWTKEEDERLVNYIKQHGEGCWRSLPKAAGLLRCGKSCR 321 MGRSPCCEKEHTNKGAWTKEEDERLV+YI+ HGEGCWRSLPKAAGLLRCGKSCR Sbjct: 1 MGRSPCCEKEHTNKGAWTKEEDERLVSYIRAHGEGCWRSLPKAAGLLRCGKSCR 54