BLASTX nr result
ID: Forsythia21_contig00040900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040900 (347 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium r... 58 2e-06 >gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium raimondii] Length = 134 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 209 PLRGK*ATCLVFRCTHSPYEIEMRPQLDSRPRLL 108 PLRG+ TCLV RCTHS YE EM PQLDSRPRLL Sbjct: 62 PLRGEGVTCLVLRCTHSRYENEMTPQLDSRPRLL 95