BLASTX nr result
ID: Forsythia21_contig00040850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040850 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007779692.1| hypothetical protein W97_03606 [Coniosporium... 102 1e-19 gb|KEQ95392.1| hypothetical protein AUEXF2481DRAFT_65372 [Aureob... 102 1e-19 gb|KEQ89215.1| ClpS-like protein [Aureobasidium pullulans EXF-150] 102 1e-19 gb|KEQ72549.1| 50S ribosomal protein L12 [Aureobasidium namibiae... 102 1e-19 gb|KEQ66624.1| ClpS-like protein [Aureobasidium melanogenum CBS ... 102 1e-19 ref|XP_001804092.1| hypothetical protein SNOG_13891 [Phaeosphaer... 102 1e-19 ref|XP_001940050.1| putative mitochondrial 54S ribosomal protein... 101 2e-19 ref|XP_008029205.1| hypothetical protein SETTUDRAFT_164853 [Seto... 99 8e-19 ref|XP_007709917.1| hypothetical protein COCCADRAFT_34763 [Bipol... 99 8e-19 ref|XP_007700619.1| hypothetical protein COCSADRAFT_328944 [Bipo... 99 8e-19 ref|XP_003296718.1| putative mitochondrial 54S ribosomal protein... 99 1e-18 ref|XP_003840733.1| similar to ribosomal protein L12 [Leptosphae... 99 1e-18 ref|XP_007685529.1| hypothetical protein COCMIDRAFT_88658 [Bipol... 98 2e-18 gb|KKY15460.1| putative mitochondrial 54s ribosomal protein mnp1... 98 2e-18 gb|KJY01874.1| 54S ribosomal protein L12 [Zymoseptoria brevis] 98 2e-18 gb|ESZ93229.1| 50S ribosomal protein L12 [Sclerotinia borealis F... 98 2e-18 gb|EMF10586.1| 50S ribosomal protein L12 [Sphaerulina musiva SO2... 98 2e-18 gb|EME45210.1| hypothetical protein DOTSEDRAFT_71055 [Dothistrom... 98 2e-18 ref|XP_003854372.1| mitochondrial ribosomal protein L12 [Zymosep... 98 2e-18 ref|XP_007586149.1| putative 50s ribosomal protein l12 protein [... 97 4e-18 >ref|XP_007779692.1| hypothetical protein W97_03606 [Coniosporium apollinis CBS 100218] gi|494827425|gb|EON64375.1| hypothetical protein W97_03606 [Coniosporium apollinis CBS 100218] Length = 177 Score = 102 bits (254), Expect = 1e-19 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVK+MLGLSLVDSKKFVESAPKMMKEGVPKEEG+KIV+TLKALGAVVVME Sbjct: 123 PKVIKEVKSMLGLSLVDSKKFVESAPKMMKEGVPKEEGQKIVDTLKALGAVVVME 177 >gb|KEQ95392.1| hypothetical protein AUEXF2481DRAFT_65372 [Aureobasidium subglaciale EXF-2481] Length = 182 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+K++LGLSLVDSKKFVESAPK+MKEGVPKEEGEKIVETLKALGAVVVME Sbjct: 128 PKVIKEIKSLLGLSLVDSKKFVESAPKLMKEGVPKEEGEKIVETLKALGAVVVME 182 >gb|KEQ89215.1| ClpS-like protein [Aureobasidium pullulans EXF-150] Length = 182 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+K++LGLSLVDSKKFVESAPK+MKEGVPKEEGEKIVETLKALGAVVVME Sbjct: 128 PKVIKEIKSLLGLSLVDSKKFVESAPKLMKEGVPKEEGEKIVETLKALGAVVVME 182 >gb|KEQ72549.1| 50S ribosomal protein L12 [Aureobasidium namibiae CBS 147.97] Length = 179 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+K++LGLSLVDSKKFVESAPK+MKEGVPKEEGEKIVETLKALGAVVVME Sbjct: 125 PKVIKEIKSLLGLSLVDSKKFVESAPKLMKEGVPKEEGEKIVETLKALGAVVVME 179 >gb|KEQ66624.1| ClpS-like protein [Aureobasidium melanogenum CBS 110374] Length = 181 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+K++LGLSLVDSKKFVESAPK+MKEGVPKEEGEKIVETLKALGAVVVME Sbjct: 127 PKVIKEIKSLLGLSLVDSKKFVESAPKLMKEGVPKEEGEKIVETLKALGAVVVME 181 >ref|XP_001804092.1| hypothetical protein SNOG_13891 [Phaeosphaeria nodorum SN15] gi|111057795|gb|EAT78915.1| hypothetical protein SNOG_13891 [Phaeosphaeria nodorum SN15] Length = 180 Score = 102 bits (253), Expect = 1e-19 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEE EKIVETLKALGA VVME Sbjct: 126 PKVIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIVETLKALGATVVME 180 >ref|XP_001940050.1| putative mitochondrial 54S ribosomal protein MNP1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976143|gb|EDU42769.1| 54S ribosomal protein L12, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 183 Score = 101 bits (252), Expect = 2e-19 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+KAMLGLSLVDSKKFVESAPKMMKEGVPKEE EKIVETLKALGA VVME Sbjct: 129 PKVIKEIKAMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIVETLKALGATVVME 183 >ref|XP_008029205.1| hypothetical protein SETTUDRAFT_164853 [Setosphaeria turcica Et28A] gi|482806434|gb|EOA83507.1| hypothetical protein SETTUDRAFT_164853 [Setosphaeria turcica Et28A] Length = 183 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVKAMLGLSLVDSKKFVESAPK+MKEGVPKEE EKIVETLKALGA VV+E Sbjct: 129 PKVIKEVKAMLGLSLVDSKKFVESAPKVMKEGVPKEEAEKIVETLKALGATVVLE 183 >ref|XP_007709917.1| hypothetical protein COCCADRAFT_34763 [Bipolaris zeicola 26-R-13] gi|451993372|gb|EMD85846.1| hypothetical protein COCHEDRAFT_1161255 [Bipolaris maydis C5] gi|452000255|gb|EMD92716.1| hypothetical protein COCHEDRAFT_1098193 [Bipolaris maydis C5] gi|477587813|gb|ENI04894.1| hypothetical protein COCC4DRAFT_40962 [Bipolaris maydis ATCC 48331] gi|576921628|gb|EUC35766.1| hypothetical protein COCCADRAFT_34763 [Bipolaris zeicola 26-R-13] gi|578485811|gb|EUN23299.1| hypothetical protein COCVIDRAFT_109081 [Bipolaris victoriae FI3] Length = 183 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVKAMLGLSLVDSKKFVESAPK+MKEGVPKEE EKIVETLKALGA VV+E Sbjct: 129 PKVIKEVKAMLGLSLVDSKKFVESAPKVMKEGVPKEEAEKIVETLKALGATVVLE 183 >ref|XP_007700619.1| hypothetical protein COCSADRAFT_328944 [Bipolaris sorokiniana ND90Pr] gi|451850229|gb|EMD63531.1| hypothetical protein COCSADRAFT_328944 [Bipolaris sorokiniana ND90Pr] Length = 183 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVKAMLGLSLVDSKKFVESAPK+MKEGVPKEE EKIVETLKALGA VV+E Sbjct: 129 PKVIKEVKAMLGLSLVDSKKFVESAPKVMKEGVPKEEAEKIVETLKALGATVVLE 183 >ref|XP_003296718.1| putative mitochondrial 54S ribosomal protein MNP1 [Pyrenophora teres f. teres 0-1] gi|311330993|gb|EFQ95174.1| hypothetical protein PTT_06896 [Pyrenophora teres f. teres 0-1] Length = 195 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+KAMLGLSLVDSKKFVESAPK+MKEGVPKEE EKIVETLKALGA V+M+ Sbjct: 129 PKVIKEIKAMLGLSLVDSKKFVESAPKLMKEGVPKEEAEKIVETLKALGATVIMD 183 >ref|XP_003840733.1| similar to ribosomal protein L12 [Leptosphaeria maculans JN3] gi|312217306|emb|CBX97254.1| similar to ribosomal protein L12 [Leptosphaeria maculans JN3] Length = 181 Score = 98.6 bits (244), Expect = 1e-18 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+KAMLGLSLVDSKKFVESAPKMMKEGV KEE EKIVETLKALGA VVME Sbjct: 127 PKVIKEIKAMLGLSLVDSKKFVESAPKMMKEGVAKEEAEKIVETLKALGATVVME 181 >ref|XP_007685529.1| hypothetical protein COCMIDRAFT_88658 [Bipolaris oryzae ATCC 44560] gi|576934470|gb|EUC47984.1| hypothetical protein COCMIDRAFT_88658 [Bipolaris oryzae ATCC 44560] Length = 183 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKEVKAMLGLSLVDSKKFVESAPK++KEGVPKEE EKIVETLKALGA VV+E Sbjct: 129 PKVIKEVKAMLGLSLVDSKKFVESAPKVLKEGVPKEEAEKIVETLKALGATVVLE 183 >gb|KKY15460.1| putative mitochondrial 54s ribosomal protein mnp1 [Diplodia seriata] Length = 183 Score = 97.8 bits (242), Expect = 2e-18 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKEVK+MLGLSLVDSKKFVESAPKMMKE VPKEE EKI+ET+K LGAVVVME Sbjct: 129 PKIIKEVKSMLGLSLVDSKKFVESAPKMMKESVPKEEAEKIIETMKGLGAVVVME 183 >gb|KJY01874.1| 54S ribosomal protein L12 [Zymoseptoria brevis] Length = 188 Score = 97.8 bits (242), Expect = 2e-18 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKE+KAMLGLSLVDSKKFVESAPKMMKEGVPKEE EKI+ETLK LG VV ME Sbjct: 134 PKIIKEIKAMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIETLKGLGGVVKME 188 >gb|ESZ93229.1| 50S ribosomal protein L12 [Sclerotinia borealis F-4157] Length = 179 Score = 97.8 bits (242), Expect = 2e-18 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKE+K+MLGLSLVDSKKFVESAPKMMKEGVPKEE EKI+ TLK LGAVVVME Sbjct: 125 PKIIKEIKSMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIATLKELGAVVVME 179 >gb|EMF10586.1| 50S ribosomal protein L12 [Sphaerulina musiva SO2202] Length = 184 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PK+IKE+KA+LGLSLVDSKKFVESAPKMMKEGVPKEE EKI+ETLKALG VV ME Sbjct: 130 PKVIKEIKALLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIETLKALGGVVKME 184 >gb|EME45210.1| hypothetical protein DOTSEDRAFT_71055 [Dothistroma septosporum NZE10] Length = 187 Score = 97.8 bits (242), Expect = 2e-18 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKE+KAMLGLSLVDSKKFVESAPKMMKEGVPKEE EKI+ETLK LG VV ME Sbjct: 133 PKIIKEIKAMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIETLKGLGGVVKME 187 >ref|XP_003854372.1| mitochondrial ribosomal protein L12 [Zymoseptoria tritici IPO323] gi|339474255|gb|EGP89348.1| hypothetical protein MYCGRDRAFT_69992 [Zymoseptoria tritici IPO323] Length = 188 Score = 97.8 bits (242), Expect = 2e-18 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKE+KAMLGLSLVDSKKFVESAPKMMKEGVPKEE EKI+ETLK LG VV ME Sbjct: 134 PKIIKEIKAMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIETLKGLGGVVKME 188 >ref|XP_007586149.1| putative 50s ribosomal protein l12 protein [Neofusicoccum parvum UCRNP2] gi|485920316|gb|EOD46377.1| putative 50s ribosomal protein l12 protein [Neofusicoccum parvum UCRNP2] Length = 198 Score = 97.1 bits (240), Expect = 4e-18 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -3 Query: 256 PKIIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEGEKIVETLKALGAVVVME 92 PKIIKEVK+MLGLSLVDSKKFVESAPK+MKE VPKEE EKI+ETLK LGAVV+ME Sbjct: 144 PKIIKEVKSMLGLSLVDSKKFVESAPKLMKESVPKEEAEKIIETLKGLGAVVIME 198