BLASTX nr result
ID: Forsythia21_contig00040817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040817 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001791287.1| hypothetical protein SNOG_00606 [Phaeosphaer... 64 3e-08 gb|ESZ99005.1| glucan 1,3-beta-glucosidase precursor [Sclerotini... 64 4e-08 ref|XP_007782639.1| hypothetical protein W97_06575 [Coniosporium... 64 4e-08 emb|CCD46564.1| glycoside hydrolase family 5 protein, partial se... 64 4e-08 ref|XP_001593115.1| glucan 1,3-beta-glucosidase [Sclerotinia scl... 64 4e-08 ref|XP_001559924.1| hypothetical protein BC1G_01483 [Botrytis ci... 64 4e-08 ref|XP_003302307.1| hypothetical protein PTT_14064 [Pyrenophora ... 64 5e-08 ref|XP_003857751.1| putative Exo-beta-1,3-glucanase [Zymoseptori... 62 1e-07 gb|KLJ12618.1| glucan 1,3-beta-glucosidase [Emmonsia parva UAMH ... 62 2e-07 ref|XP_001941009.1| glucan 1,3-beta-glucosidase precursor [Pyren... 62 2e-07 gb|KHJ33940.1| putative glucan -beta-glucosidase [Erysiphe necator] 62 2e-07 ref|XP_008025333.1| glycoside hydrolase family 5 protein [Setosp... 62 2e-07 gb|EQL37144.1| glucan 1,3-beta-glucosidase [Blastomyces dermatit... 61 3e-07 gb|EEQ86572.1| glucan 1,3-beta-glucosidase [Blastomyces dermatit... 61 3e-07 ref|XP_002624761.1| glucan 1,3-beta-glucosidase [Blastomyces der... 61 3e-07 ref|XP_002792488.1| glucan 1,3-beta-glucosidase [Paracoccidioide... 61 3e-07 gb|KKZ61035.1| glucan 1,3-beta-glucosidase [Emmonsia crescens UA... 61 3e-07 ref|XP_007291784.1| putative Glucan 1,3-beta-glucosidase [Marsso... 60 4e-07 ref|XP_003834837.1| hypothetical protein LEMA_P069800.1 [Leptosp... 59 1e-06 ref|XP_001540744.1| glucan 1,3-beta-glucosidase [Histoplasma cap... 59 1e-06 >ref|XP_001791287.1| hypothetical protein SNOG_00606 [Phaeosphaeria nodorum SN15] gi|111070981|gb|EAT92101.1| hypothetical protein SNOG_00606 [Phaeosphaeria nodorum SN15] Length = 408 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY-GICG 151 WIFWTWKTE APEWD QDL+ NG+ PQP ++ Y G CG Sbjct: 369 WIFWTWKTEGAPEWDMQDLLANGIFPQPLTSRKYPGQCG 407 >gb|ESZ99005.1| glucan 1,3-beta-glucosidase precursor [Sclerotinia borealis F-4157] Length = 421 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYG 160 W+FWTWKTESAPEW FQ+L R G+IPQP ++ YG Sbjct: 374 WVFWTWKTESAPEWHFQNLTRAGLIPQPLTSRKYG 408 >ref|XP_007782639.1| hypothetical protein W97_06575 [Coniosporium apollinis CBS 100218] gi|494830807|gb|EON67322.1| hypothetical protein W97_06575 [Coniosporium apollinis CBS 100218] Length = 415 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY-GICG 151 WIFWTWKTE APEWD QDL+ NG+ PQP + Y G CG Sbjct: 376 WIFWTWKTEGAPEWDMQDLLANGIFPQPLDSRKYPGQCG 414 >emb|CCD46564.1| glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4] Length = 146 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYG 160 W+FWTWKTESAPEW FQ+L R G+IPQP ++ YG Sbjct: 99 WVFWTWKTESAPEWHFQNLTRAGLIPQPLTSRKYG 133 >ref|XP_001593115.1| glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980] gi|154703817|gb|EDO03556.1| glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70] Length = 421 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYG 160 W+FWTWKTESAPEW FQ+L R G+IPQP ++ YG Sbjct: 374 WVFWTWKTESAPEWHFQNLTRAGLIPQPLTSRKYG 408 >ref|XP_001559924.1| hypothetical protein BC1G_01483 [Botrytis cinerea B05.10] gi|472246726|gb|EMR91254.1| putative exo-beta glucanase protein [Botrytis cinerea BcDW1] Length = 406 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYG 160 W+FWTWKTESAPEW FQ+L R G+IPQP ++ YG Sbjct: 359 WVFWTWKTESAPEWHFQNLTRAGLIPQPLTSRKYG 393 >ref|XP_003302307.1| hypothetical protein PTT_14064 [Pyrenophora teres f. teres 0-1] gi|311322427|gb|EFQ89593.1| hypothetical protein PTT_14064 [Pyrenophora teres f. teres 0-1] Length = 406 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY 163 WIFWTWKTE APEWD QDL+ NG+ PQP +A Y Sbjct: 368 WIFWTWKTEGAPEWDMQDLLANGLFPQPLTARKY 401 >ref|XP_003857751.1| putative Exo-beta-1,3-glucanase [Zymoseptoria tritici IPO323] gi|339477636|gb|EGP92727.1| putative Exo-beta-1,3-glucanase [Zymoseptoria tritici IPO323] Length = 417 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSA 172 WIFWTWK E+APEW FQ+L R G++PQPFSA Sbjct: 383 WIFWTWKNEAAPEWHFQNLTREGLVPQPFSA 413 >gb|KLJ12618.1| glucan 1,3-beta-glucosidase [Emmonsia parva UAMH 139] Length = 419 Score = 62.0 bits (149), Expect = 2e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +PEWD QDL+ G+ PQPF+ YG C Sbjct: 382 WFFWTWKTEGSPEWDMQDLLSAGLFPQPFTDRKYGGC 418 >ref|XP_001941009.1| glucan 1,3-beta-glucosidase precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977102|gb|EDU43728.1| glucan 1,3-beta-glucosidase precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 406 Score = 62.0 bits (149), Expect = 2e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY 163 WIFWTWKTE APEWD +DL+ NG+ PQP +A Y Sbjct: 368 WIFWTWKTEGAPEWDMKDLLANGLFPQPLTARKY 401 >gb|KHJ33940.1| putative glucan -beta-glucosidase [Erysiphe necator] Length = 424 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSA 172 WIFWTWKTESAPEW FQ+L R G+IPQP +A Sbjct: 377 WIFWTWKTESAPEWHFQNLTRAGLIPQPLTA 407 >ref|XP_008025333.1| glycoside hydrolase family 5 protein [Setosphaeria turcica Et28A] gi|482809906|gb|EOA86712.1| glycoside hydrolase family 5 protein [Setosphaeria turcica Et28A] Length = 415 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/39 (64%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY-GICG 151 WIFWTWKTE+APEWD Q L+ NG+ P+P +A Y G CG Sbjct: 377 WIFWTWKTEAAPEWDMQQLLANGVFPKPVTARKYPGQCG 415 >gb|EQL37144.1| glucan 1,3-beta-glucosidase [Blastomyces dermatitidis ATCC 26199] Length = 419 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +PEWD QDL+ G+ PQPF YG C Sbjct: 382 WFFWTWKTEGSPEWDMQDLLSAGLFPQPFRDRRYGGC 418 >gb|EEQ86572.1| glucan 1,3-beta-glucosidase [Blastomyces dermatitidis ER-3] gi|327350175|gb|EGE79032.1| glucan 1,3-beta-glucosidase [Blastomyces dermatitidis ATCC 18188] Length = 419 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +PEWD QDL+ G+ PQPF YG C Sbjct: 382 WFFWTWKTEGSPEWDMQDLLSAGLFPQPFRDRKYGGC 418 >ref|XP_002624761.1| glucan 1,3-beta-glucosidase [Blastomyces dermatitidis SLH14081] gi|239596006|gb|EEQ78587.1| glucan 1,3-beta-glucosidase [Blastomyces dermatitidis SLH14081] Length = 419 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +PEWD QDL+ G+ PQPF YG C Sbjct: 382 WFFWTWKTEGSPEWDMQDLLSAGLFPQPFRDRKYGGC 418 >ref|XP_002792488.1| glucan 1,3-beta-glucosidase [Paracoccidioides sp. 'lutzii' Pb01] gi|226279158|gb|EEH34724.1| glucan 1,3-beta-glucosidase [Paracoccidioides sp. 'lutzii' Pb01] Length = 416 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE AP WD +DL++ + PQPFSA YG C Sbjct: 379 WFFWTWKTEGAPGWDMRDLLKQELFPQPFSARKYGGC 415 >gb|KKZ61035.1| glucan 1,3-beta-glucosidase [Emmonsia crescens UAMH 3008] Length = 414 Score = 60.8 bits (146), Expect = 3e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +PEWD QDL+ G+ PQP + YG C Sbjct: 377 WFFWTWKTEGSPEWDMQDLLSEGLFPQPLADRKYGWC 413 >ref|XP_007291784.1| putative Glucan 1,3-beta-glucosidase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865080|gb|EKD18123.1| putative Glucan 1,3-beta-glucosidase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 427 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSA 172 WIFW WKTESAPEW+F+DL R G+IPQP +A Sbjct: 380 WIFWAWKTESAPEWNFRDLTRAGIIPQPLTA 410 >ref|XP_003834837.1| hypothetical protein LEMA_P069800.1 [Leptosphaeria maculans JN3] gi|312211387|emb|CBX91472.1| hypothetical protein LEMA_P069800.1 [Leptosphaeria maculans JN3] Length = 650 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINY-GICG 151 WIFWTWKTE APEWD Q L+ G+ PQP +A Y G CG Sbjct: 612 WIFWTWKTEGAPEWDMQALLAAGIFPQPLTARKYPGQCG 650 >ref|XP_001540744.1| glucan 1,3-beta-glucosidase [Histoplasma capsulatum NAm1] gi|150412687|gb|EDN08074.1| glucan 1,3-beta-glucosidase [Histoplasma capsulatum NAm1] Length = 416 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -3 Query: 264 WIFWTWKTESAPEWDFQDLVRNGMIPQPFSAINYGIC 154 W FWTWKTE +P WD QDL+ G+ PQPF+ YG C Sbjct: 379 WFFWTWKTEGSPGWDMQDLLSAGLFPQPFTNRKYGGC 415