BLASTX nr result
ID: Forsythia21_contig00040749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040749 (385 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009757267.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_009624311.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_012832109.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_006363060.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_006338996.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_004249603.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_004246848.1| PREDICTED: UPF0503 protein At3g09070, chloro... 70 7e-10 ref|XP_012850371.1| PREDICTED: UPF0503 protein At3g09070, chloro... 69 9e-10 emb|CDP06515.1| unnamed protein product [Coffea canephora] 67 5e-09 emb|CDP21230.1| unnamed protein product [Coffea canephora] gi|66... 67 5e-09 ref|XP_011077591.1| PREDICTED: UPF0503 protein At3g09070, chloro... 67 6e-09 ref|XP_009627433.1| PREDICTED: UPF0503 protein At3g09070, chloro... 65 1e-08 ref|XP_002273894.1| PREDICTED: UPF0503 protein At3g09070, chloro... 65 1e-08 gb|EPS70064.1| hypothetical protein M569_04698, partial [Genlise... 64 4e-08 ref|XP_009787553.1| PREDICTED: UPF0503 protein At3g09070, chloro... 64 5e-08 ref|XP_010558360.1| PREDICTED: UPF0503 protein At3g09070, chloro... 63 7e-08 ref|XP_006299294.1| hypothetical protein CARUB_v10015448mg [Caps... 62 2e-07 ref|XP_010464543.1| PREDICTED: UPF0503 protein At3g09070, chloro... 61 3e-07 ref|XP_010468834.1| PREDICTED: UPF0503 protein At3g09070, chloro... 61 3e-07 ref|XP_009135068.1| PREDICTED: UPF0503 protein At3g09070, chloro... 61 3e-07 >ref|XP_009757267.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Nicotiana sylvestris] Length = 660 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHPDEQFTGFCP CLCERLTTLD Sbjct: 22 RSSFSCDRHPDEQFTGFCPECLCERLTTLD 51 >ref|XP_009624311.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic [Nicotiana tomentosiformis] Length = 661 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHPDEQFTGFCP CLCERLTTLD Sbjct: 22 RSSFSCDRHPDEQFTGFCPECLCERLTTLD 51 >ref|XP_012832109.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Erythranthe guttatus] gi|604342813|gb|EYU41837.1| hypothetical protein MIMGU_mgv1a002573mg [Erythranthe guttata] Length = 657 Score = 69.7 bits (169), Expect = 7e-10 Identities = 38/61 (62%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ---XXXXXXXXXXXXXXXXXXAIKSLFSS 4 RSSFSCDRHP EQF+GFCPSCLCERLTTLDQ AIKSLFSS Sbjct: 22 RSSFSCDRHPTEQFSGFCPSCLCERLTTLDQSSTNTPSSSRRPSSASAAAAAAIKSLFSS 81 Query: 3 S 1 S Sbjct: 82 S 82 >ref|XP_006363060.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Solanum tuberosum] Length = 659 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHPDEQFTGFCP CLCERLTTLD Sbjct: 23 RSSFSCDRHPDEQFTGFCPECLCERLTTLD 52 >ref|XP_006338996.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Solanum tuberosum] Length = 641 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 RSSFSCDRHPDE FTGFCP CLCERLTTLDQ Sbjct: 21 RSSFSCDRHPDEDFTGFCPECLCERLTTLDQ 51 >ref|XP_004249603.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Solanum lycopersicum] Length = 641 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 RSSFSCDRHPDE FTGFCP CLCERLTTLDQ Sbjct: 21 RSSFSCDRHPDEDFTGFCPECLCERLTTLDQ 51 >ref|XP_004246848.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic [Solanum lycopersicum] Length = 659 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHPDEQFTGFCP CLCERLTTLD Sbjct: 23 RSSFSCDRHPDEQFTGFCPECLCERLTTLD 52 >ref|XP_012850371.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Erythranthe guttatus] gi|604313312|gb|EYU26643.1| hypothetical protein MIMGU_mgv1a002363mg [Erythranthe guttata] Length = 684 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHPDE FTGFCPSCLCERLTTLD Sbjct: 20 RSSFSCDRHPDEHFTGFCPSCLCERLTTLD 49 >emb|CDP06515.1| unnamed protein product [Coffea canephora] Length = 633 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 RSSFSCDRH EQFTGFCPSCLCERLTTLDQ Sbjct: 20 RSSFSCDRHLQEQFTGFCPSCLCERLTTLDQ 50 >emb|CDP21230.1| unnamed protein product [Coffea canephora] gi|661875723|emb|CDP19925.1| unnamed protein product [Coffea canephora] Length = 69 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 RSSFSCDRH EQFTGFCPSCLCERLTTLDQ Sbjct: 20 RSSFSCDRHLQEQFTGFCPSCLCERLTTLDQ 50 >ref|XP_011077591.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Sesamum indicum] Length = 674 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHP E FTGFCPSCLCERLTTLD Sbjct: 20 RSSFSCDRHPHEHFTGFCPSCLCERLTTLD 49 >ref|XP_009627433.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like isoform X1 [Nicotiana tomentosiformis] gi|697146580|ref|XP_009627435.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like isoform X2 [Nicotiana tomentosiformis] Length = 636 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHP EQF+GFCP CLCERLTTLD Sbjct: 25 RSSFSCDRHPHEQFSGFCPECLCERLTTLD 54 >ref|XP_002273894.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Vitis vinifera] gi|731401181|ref|XP_010654197.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Vitis vinifera] Length = 663 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 RSSF+CDRHPDE FTGFCPSCLCERL LDQ Sbjct: 19 RSSFACDRHPDEHFTGFCPSCLCERLAGLDQ 49 >gb|EPS70064.1| hypothetical protein M569_04698, partial [Genlisea aurea] Length = 592 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHP E FTGFCPSCLCERLT+LD Sbjct: 16 RSSFSCDRHPAEVFTGFCPSCLCERLTSLD 45 >ref|XP_009787553.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like isoform X1 [Nicotiana sylvestris] gi|698481081|ref|XP_009787554.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like isoform X2 [Nicotiana sylvestris] Length = 629 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLD 85 RSSFSCDRHP E F+GFCP CLCERLTTLD Sbjct: 25 RSSFSCDRHPHEHFSGFCPECLCERLTTLD 54 >ref|XP_010558360.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic [Tarenaya hassleriana] Length = 665 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 R S SCDRHPDE+FTGFCPSCLCERL+ LDQ Sbjct: 17 RPSTSCDRHPDERFTGFCPSCLCERLSVLDQ 47 >ref|XP_006299294.1| hypothetical protein CARUB_v10015448mg [Capsella rubella] gi|482568003|gb|EOA32192.1| hypothetical protein CARUB_v10015448mg [Capsella rubella] Length = 671 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/58 (51%), Positives = 35/58 (60%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQXXXXXXXXXXXXXXXXXXAIKSLFSSS 1 R S SCDRHP+E+FTGFCPSCLCERL+ LDQ A+K+LF S Sbjct: 28 RLSTSCDRHPEERFTGFCPSCLCERLSVLDQTNNGASSSSRKPPTISAAALKALFKPS 85 >ref|XP_010464543.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Camelina sativa] Length = 684 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 R S SCDRHP+E+FTGFCPSCLCERL+ LDQ Sbjct: 31 RLSTSCDRHPEERFTGFCPSCLCERLSVLDQ 61 >ref|XP_010468834.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic [Camelina sativa] Length = 679 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 R S SCDRHP+E+FTGFCPSCLCERL+ LDQ Sbjct: 31 RLSTSCDRHPEERFTGFCPSCLCERLSVLDQ 61 >ref|XP_009135068.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Brassica rapa] Length = 659 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 174 RSSFSCDRHPDEQFTGFCPSCLCERLTTLDQ 82 R S SCDRHP+E+FTGFCPSCLCERL+ LDQ Sbjct: 22 RLSTSCDRHPEERFTGFCPSCLCERLSVLDQ 52