BLASTX nr result
ID: Forsythia21_contig00040434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040434 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ85839.1| hypothetical protein M438DRAFT_373375 [Aureobasid... 77 6e-12 gb|EMD87240.1| hypothetical protein COCHEDRAFT_1184045 [Bipolari... 76 8e-12 ref|XP_007688243.1| hypothetical protein COCMIDRAFT_96055 [Bipol... 75 2e-11 gb|KEQ75757.1| hypothetical protein M436DRAFT_39373 [Aureobasidi... 74 4e-11 ref|XP_008024006.1| hypothetical protein SETTUDRAFT_168450 [Seto... 74 4e-11 gb|EUN25609.1| hypothetical protein COCVIDRAFT_102957 [Bipolaris... 74 5e-11 ref|XP_007709374.1| hypothetical protein COCCADRAFT_23899 [Bipol... 74 5e-11 ref|XP_007704189.1| hypothetical protein COCSADRAFT_246597 [Bipo... 74 5e-11 ref|XP_003837065.1| hypothetical protein LEMA_P032990.1 [Leptosp... 73 6e-11 dbj|GAM83655.1| hypothetical protein ANO11243_016430 [fungal sp.... 73 8e-11 ref|XP_003297387.1| hypothetical protein PTT_07771 [Pyrenophora ... 72 1e-10 ref|XP_007776987.1| hypothetical protein W97_00886 [Coniosporium... 71 2e-10 gb|KEQ60687.1| hypothetical protein M437DRAFT_67863 [Aureobasidi... 71 3e-10 ref|XP_001934120.1| hypothetical protein PTRG_03787 [Pyrenophora... 71 3e-10 ref|XP_003855318.1| hypothetical protein MYCGRDRAFT_68994 [Zymos... 70 5e-10 gb|EME47090.1| hypothetical protein DOTSEDRAFT_20899 [Dothistrom... 70 7e-10 gb|EMF16079.1| hypothetical protein SEPMUDRAFT_147749 [Sphaeruli... 69 2e-09 gb|KJX98949.1| hypothetical protein TI39_contig380g00029 [Zymose... 68 2e-09 gb|KEQ92742.1| hypothetical protein AUEXF2481DRAFT_416953 [Aureo... 65 1e-08 ref|XP_007580315.1| putative btb poz-like protein [Neofusicoccum... 64 4e-08 >gb|KEQ85839.1| hypothetical protein M438DRAFT_373375 [Aureobasidium pullulans EXF-150] Length = 272 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ Q+KPL+ELLSRDMVDIYVGQENTHWILH+KLLCYRS Sbjct: 1 MAEQQDKPLHELLSRDMVDIYVGQENTHWILHQKLLCYRS 40 >gb|EMD87240.1| hypothetical protein COCHEDRAFT_1184045 [Bipolaris maydis C5] gi|477583265|gb|ENI00365.1| hypothetical protein COCC4DRAFT_53775 [Bipolaris maydis ATCC 48331] Length = 315 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS AQEKPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSNAQEKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >ref|XP_007688243.1| hypothetical protein COCMIDRAFT_96055 [Bipolaris oryzae ATCC 44560] gi|576931653|gb|EUC45209.1| hypothetical protein COCMIDRAFT_96055 [Bipolaris oryzae ATCC 44560] Length = 310 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS QEKPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSNVQEKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >gb|KEQ75757.1| hypothetical protein M436DRAFT_39373 [Aureobasidium namibiae CBS 147.97] Length = 271 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ Q+KPLNELLS DMVDIYVGQENT WILHEKLLCYRS Sbjct: 1 MAEHQDKPLNELLSHDMVDIYVGQENTKWILHEKLLCYRS 40 >ref|XP_008024006.1| hypothetical protein SETTUDRAFT_168450 [Setosphaeria turcica Et28A] gi|482811890|gb|EOA88635.1| hypothetical protein SETTUDRAFT_168450 [Setosphaeria turcica Et28A] Length = 308 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 120 MSG-AQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MSG AQEKPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSGVAQEKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 41 >gb|EUN25609.1| hypothetical protein COCVIDRAFT_102957 [Bipolaris victoriae FI3] Length = 310 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS Q+KPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSNVQDKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >ref|XP_007709374.1| hypothetical protein COCCADRAFT_23899 [Bipolaris zeicola 26-R-13] gi|576922178|gb|EUC36309.1| hypothetical protein COCCADRAFT_23899 [Bipolaris zeicola 26-R-13] Length = 310 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS Q+KPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSNVQDKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >ref|XP_007704189.1| hypothetical protein COCSADRAFT_246597 [Bipolaris sorokiniana ND90Pr] gi|451846591|gb|EMD59900.1| hypothetical protein COCSADRAFT_246597 [Bipolaris sorokiniana ND90Pr] Length = 302 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS Q+KPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MSNVQDKPLNELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >ref|XP_003837065.1| hypothetical protein LEMA_P032990.1 [Leptosphaeria maculans JN3] gi|312213623|emb|CBX93625.1| hypothetical protein LEMA_P032990.1 [Leptosphaeria maculans JN3] Length = 330 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 MS Q+KPLNELLSR MVDIY+G ENTHWILHEKLLC+ S Sbjct: 1 MSNVQDKPLNELLSRSMVDIYIGPENTHWILHEKLLCHHS 40 >dbj|GAM83655.1| hypothetical protein ANO11243_016430 [fungal sp. No.11243] Length = 364 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 129 TEIMSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 T M +E+PL+ELLSRDMVDIYVG ENTHWILHEKLLC+RS Sbjct: 102 TLAMEDQKERPLHELLSRDMVDIYVGSENTHWILHEKLLCHRS 144 >ref|XP_003297387.1| hypothetical protein PTT_07771 [Pyrenophora teres f. teres 0-1] gi|311329967|gb|EFQ94522.1| hypothetical protein PTT_07771 [Pyrenophora teres f. teres 0-1] Length = 308 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ A EKPLNELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MANAPEKPLNELLSRSMVDIYVGPENTHWILHEKLLCHYS 40 >ref|XP_007776987.1| hypothetical protein W97_00886 [Coniosporium apollinis CBS 100218] gi|494824379|gb|EON61670.1| hypothetical protein W97_00886 [Coniosporium apollinis CBS 100218] Length = 280 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 129 TEIMSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 T+ +EK L+ELLSRD+VDIYVG ENTHWILHEKLLCYRS Sbjct: 4 TQSQPAQREKQLHELLSRDLVDIYVGSENTHWILHEKLLCYRS 46 >gb|KEQ60687.1| hypothetical protein M437DRAFT_67863 [Aureobasidium melanogenum CBS 110374] Length = 274 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ Q+KPL+ELLSR+MVD+Y+GQENT W+LHEKLLCYRS Sbjct: 1 MAEHQDKPLHELLSREMVDLYIGQENTKWVLHEKLLCYRS 40 >ref|XP_001934120.1| hypothetical protein PTRG_03787 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979999|gb|EDU46625.1| hypothetical protein PTRG_03787 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 308 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ A EKPL+ELLSR MVDIYVG ENTHWILHEKLLC+ S Sbjct: 1 MANAPEKPLHELLSRSMVDIYVGPENTHWILHEKLLCHHS 40 >ref|XP_003855318.1| hypothetical protein MYCGRDRAFT_68994 [Zymoseptoria tritici IPO323] gi|339475202|gb|EGP90294.1| hypothetical protein MYCGRDRAFT_68994 [Zymoseptoria tritici IPO323] Length = 248 Score = 70.1 bits (170), Expect = 5e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 105 EKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 E+PLNELLSRDMVDIYVG +NT W+LHEKLLCYRS Sbjct: 7 ERPLNELLSRDMVDIYVGSDNTRWVLHEKLLCYRS 41 >gb|EME47090.1| hypothetical protein DOTSEDRAFT_20899 [Dothistroma septosporum NZE10] Length = 276 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 108 QEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 +E+PLNELLSR+MVDIYVG NTHWILH+KLLCYRS Sbjct: 6 KERPLNELLSREMVDIYVGPSNTHWILHKKLLCYRS 41 >gb|EMF16079.1| hypothetical protein SEPMUDRAFT_147749 [Sphaerulina musiva SO2202] Length = 272 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -2 Query: 108 QEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 +++PL+ELLSRDMVDIYVG +NTHW LHEKLLCYRS Sbjct: 13 RDRPLHELLSRDMVDIYVGPQNTHWTLHEKLLCYRS 48 >gb|KJX98949.1| hypothetical protein TI39_contig380g00029 [Zymoseptoria brevis] Length = 244 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 105 EKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 E+PL+ELLSRDMVDIYVG +NT W+LHEKLLCYRS Sbjct: 3 ERPLHELLSRDMVDIYVGSDNTRWVLHEKLLCYRS 37 >gb|KEQ92742.1| hypothetical protein AUEXF2481DRAFT_416953 [Aureobasidium subglaciale EXF-2481] Length = 266 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -2 Query: 120 MSGAQEKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 M+ Q KPL+ELLS DMVDIYVG EN W LHEKLLCYRS Sbjct: 1 MAEQQNKPLHELLSHDMVDIYVGPENNKWTLHEKLLCYRS 40 >ref|XP_007580315.1| putative btb poz-like protein [Neofusicoccum parvum UCRNP2] gi|485928436|gb|EOD52143.1| putative btb poz-like protein [Neofusicoccum parvum UCRNP2] Length = 281 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 105 EKPLNELLSRDMVDIYVGQENTHWILHEKLLCYRS 1 EKPL+ELLS +VDIYVG ENTHWILHEKLLC RS Sbjct: 11 EKPLHELLSHALVDIYVGTENTHWILHEKLLCARS 45