BLASTX nr result
ID: Forsythia21_contig00040308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040308 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012079940.1| PREDICTED: alpha/beta hydrolase domain-conta... 74 3e-11 ref|XP_010102924.1| hypothetical protein L484_018942 [Morus nota... 73 6e-11 ref|XP_002511280.1| Protein bem46, putative [Ricinus communis] g... 73 6e-11 ref|XP_011086992.1| PREDICTED: alpha/beta hydrolase domain-conta... 71 2e-10 gb|KJB38733.1| hypothetical protein B456_006G269800 [Gossypium r... 70 4e-10 gb|KJB38732.1| hypothetical protein B456_006G269800 [Gossypium r... 70 4e-10 ref|XP_012487608.1| PREDICTED: alpha/beta hydrolase domain-conta... 70 4e-10 gb|KHG06321.1| Abhydrolase domain-containing protein [Gossypium ... 70 4e-10 ref|XP_007037809.1| Alpha/beta-Hydrolases superfamily protein is... 70 5e-10 ref|XP_007037808.1| Alpha/beta-Hydrolases superfamily protein is... 70 5e-10 emb|CDP15092.1| unnamed protein product [Coffea canephora] 69 9e-10 ref|XP_007210038.1| hypothetical protein PRUPE_ppa017226mg [Prun... 68 3e-09 ref|XP_010695987.1| PREDICTED: alpha/beta hydrolase domain-conta... 67 6e-09 ref|XP_010663064.1| PREDICTED: alpha/beta hydrolase domain-conta... 66 8e-09 emb|CBI14904.3| unnamed protein product [Vitis vinifera] 66 8e-09 ref|XP_008464486.1| PREDICTED: alpha/beta hydrolase domain-conta... 66 1e-08 gb|KDO37421.1| hypothetical protein CISIN_1g030906mg [Citrus sin... 66 1e-08 ref|XP_006476931.1| PREDICTED: alpha/beta hydrolase domain-conta... 66 1e-08 ref|XP_006439983.1| hypothetical protein CICLE_v10020676mg [Citr... 66 1e-08 ref|XP_004138073.1| PREDICTED: alpha/beta hydrolase domain-conta... 66 1e-08 >ref|XP_012079940.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Jatropha curcas] gi|643720736|gb|KDP31000.1| hypothetical protein JCGZ_11376 [Jatropha curcas] Length = 371 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 +ERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA Sbjct: 334 MERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 370 >ref|XP_010102924.1| hypothetical protein L484_018942 [Morus notabilis] gi|587906370|gb|EXB94442.1| hypothetical protein L484_018942 [Morus notabilis] Length = 372 Score = 73.2 bits (178), Expect = 6e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 VERSRRSVEYHEKSRRSID QLEKARKSVDWLDRIRA Sbjct: 335 VERSRRSVEYHEKSRRSIDQQLEKARKSVDWLDRIRA 371 >ref|XP_002511280.1| Protein bem46, putative [Ricinus communis] gi|223550395|gb|EEF51882.1| Protein bem46, putative [Ricinus communis] Length = 371 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 +ERSRRSVEYH+KSRRSIDLQLEKARKSVDWLDRIRA Sbjct: 334 MERSRRSVEYHDKSRRSIDLQLEKARKSVDWLDRIRA 370 >ref|XP_011086992.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Sesamum indicum] Length = 371 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 +ERSRRSVEYHEKSR SID+QLEKARKSVDWLDRIRA Sbjct: 334 MERSRRSVEYHEKSRMSIDIQLEKARKSVDWLDRIRA 370 >gb|KJB38733.1| hypothetical protein B456_006G269800 [Gossypium raimondii] Length = 378 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYHEKSRRS+DLQLEK RKSVDW+DRI AV Sbjct: 341 MERSRRSVEYHEKSRRSVDLQLEKGRKSVDWIDRIPAV 378 >gb|KJB38732.1| hypothetical protein B456_006G269800 [Gossypium raimondii] Length = 382 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYHEKSRRS+DLQLEK RKSVDW+DRI AV Sbjct: 345 MERSRRSVEYHEKSRRSVDLQLEKGRKSVDWIDRIPAV 382 >ref|XP_012487608.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Gossypium raimondii] gi|763771516|gb|KJB38731.1| hypothetical protein B456_006G269800 [Gossypium raimondii] Length = 395 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYHEKSRRS+DLQLEK RKSVDW+DRI AV Sbjct: 358 MERSRRSVEYHEKSRRSVDLQLEKGRKSVDWIDRIPAV 395 >gb|KHG06321.1| Abhydrolase domain-containing protein [Gossypium arboreum] Length = 286 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYHEKSRRS+DLQLEK RKSVDW+DRI AV Sbjct: 249 MERSRRSVEYHEKSRRSVDLQLEKGRKSVDWIDRIPAV 286 >ref|XP_007037809.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] gi|508775054|gb|EOY22310.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 317 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYH+KSRRSID QLEKARKSVDWLDRI AV Sbjct: 280 MERSRRSVEYHDKSRRSIDHQLEKARKSVDWLDRIEAV 317 >ref|XP_007037808.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508775053|gb|EOY22309.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 398 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYH+KSRRSID QLEKARKSVDWLDRI AV Sbjct: 361 MERSRRSVEYHDKSRRSIDHQLEKARKSVDWLDRIEAV 398 >emb|CDP15092.1| unnamed protein product [Coffea canephora] Length = 370 Score = 69.3 bits (168), Expect = 9e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 +ERSRRSVEYHEKSR SIDLQ EKARKSVDWLDRIRA Sbjct: 333 MERSRRSVEYHEKSRMSIDLQPEKARKSVDWLDRIRA 369 >ref|XP_007210038.1| hypothetical protein PRUPE_ppa017226mg [Prunus persica] gi|462405773|gb|EMJ11237.1| hypothetical protein PRUPE_ppa017226mg [Prunus persica] Length = 378 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/38 (92%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = -1 Query: 291 VERSRRSVEYH-EKSRRSIDLQLEKARKSVDWLDRIRA 181 +ERSRRSVEYH EKSRRSID QLEKARKSVDWLDRIRA Sbjct: 340 IERSRRSVEYHHEKSRRSIDHQLEKARKSVDWLDRIRA 377 >ref|XP_010695987.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Beta vulgaris subsp. vulgaris] gi|870844224|gb|KMS97257.1| hypothetical protein BVRB_7g177040 [Beta vulgaris subsp. vulgaris] Length = 372 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRAV 178 +ERSRRSVEYH++SR+S+DLQ EK R+SVDW+DRIRAV Sbjct: 335 LERSRRSVEYHDRSRKSVDLQFEKGRRSVDWVDRIRAV 372 >ref|XP_010663064.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Vitis vinifera] Length = 387 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 VERSRRSVEY++KSRRSI+ QLE+ARKSVDWLDRIRA Sbjct: 350 VERSRRSVEYNDKSRRSINQQLERARKSVDWLDRIRA 386 >emb|CBI14904.3| unnamed protein product [Vitis vinifera] Length = 359 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 VERSRRSVEY++KSRRSI+ QLE+ARKSVDWLDRIRA Sbjct: 322 VERSRRSVEYNDKSRRSINQQLERARKSVDWLDRIRA 358 >ref|XP_008464486.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Cucumis melo] Length = 371 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 VERSRRSVE++EK RRSID Q EKARKSVDWLDRIRA Sbjct: 334 VERSRRSVEFYEKPRRSIDQQFEKARKSVDWLDRIRA 370 >gb|KDO37421.1| hypothetical protein CISIN_1g030906mg [Citrus sinensis] Length = 169 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIR 184 +E+SRRSV+YHEKSR+SID QLE+ARKSVDWLDRIR Sbjct: 132 MEKSRRSVDYHEKSRKSIDQQLERARKSVDWLDRIR 167 >ref|XP_006476931.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Citrus sinensis] Length = 371 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIR 184 +E+SRRSV+YHEKSR+SID QLE+ARKSVDWLDRIR Sbjct: 334 MEKSRRSVDYHEKSRKSIDQQLERARKSVDWLDRIR 369 >ref|XP_006439983.1| hypothetical protein CICLE_v10020676mg [Citrus clementina] gi|557542245|gb|ESR53223.1| hypothetical protein CICLE_v10020676mg [Citrus clementina] Length = 371 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIR 184 +E+SRRSV+YHEKSR+SID QLE+ARKSVDWLDRIR Sbjct: 334 MEKSRRSVDYHEKSRKSIDQQLERARKSVDWLDRIR 369 >ref|XP_004138073.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Cucumis sativus] gi|700208418|gb|KGN63514.1| hypothetical protein Csa_1G002830 [Cucumis sativus] Length = 371 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 291 VERSRRSVEYHEKSRRSIDLQLEKARKSVDWLDRIRA 181 VERSRRSVE++EK RRSID Q EKARKSVDWLDRIRA Sbjct: 334 VERSRRSVEFYEKPRRSIDQQFEKARKSVDWLDRIRA 370