BLASTX nr result
ID: Forsythia21_contig00040049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040049 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001059932.1| Os07g0549200 [Oryza sativa Japonica Group] g... 60 7e-07 gb|EAZ40216.1| hypothetical protein OsJ_24661 [Oryza sativa Japo... 60 7e-07 ref|XP_008813168.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_009764479.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_009608579.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_012849406.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 dbj|BAK03258.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 3e-06 ref|XP_010043480.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_009350168.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 57 5e-06 ref|XP_006360926.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 ref|XP_006858620.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 gb|EPS64983.1| hypothetical protein M569_09798, partial [Genlise... 57 6e-06 ref|XP_012066943.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_011032219.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_010928561.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_009350170.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_009350169.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_008384905.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 gb|KDP42187.1| hypothetical protein JCGZ_02917 [Jatropha curcas] 56 8e-06 ref|XP_002517255.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|NP_001059932.1| Os07g0549200 [Oryza sativa Japonica Group] gi|28564798|dbj|BAC57728.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113611468|dbj|BAF21846.1| Os07g0549200 [Oryza sativa Japonica Group] gi|215766634|dbj|BAG98696.1| unnamed protein product [Oryza sativa Japonica Group] gi|218199812|gb|EEC82239.1| hypothetical protein OsI_26409 [Oryza sativa Indica Group] Length = 262 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 103 PQQFGWERVRAYHDGRPRGPLWRGKKLIGKEAIF 2 P G ER RA+HDGRPRGPLWR KKLIGKEA+F Sbjct: 51 PPPHGCERRRAFHDGRPRGPLWRSKKLIGKEALF 84 >gb|EAZ40216.1| hypothetical protein OsJ_24661 [Oryza sativa Japonica Group] Length = 256 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 103 PQQFGWERVRAYHDGRPRGPLWRGKKLIGKEAIF 2 P G ER RA+HDGRPRGPLWR KKLIGKEA+F Sbjct: 51 PPPHGCERRRAFHDGRPRGPLWRSKKLIGKEALF 84 >ref|XP_008813168.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Phoenix dactylifera] gi|672186767|ref|XP_008813169.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Phoenix dactylifera] Length = 255 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 109 TNPQQFGWERVRAYHDGRPRGPLWRGKKLIGKEAIF 2 T+P++ +E + YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 42 THPREQIFELRQLYHDGRPRGPLWRGKKLIGKEALF 77 >ref|XP_009764479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Nicotiana sylvestris] Length = 257 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 VR YHDGRPRGPLWRGKKLIGKEAIF Sbjct: 54 VRFYHDGRPRGPLWRGKKLIGKEAIF 79 >ref|XP_009608579.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Nicotiana tomentosiformis] Length = 257 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 VR YHDGRPRGPLWRGKKLIGKEAIF Sbjct: 54 VRFYHDGRPRGPLWRGKKLIGKEAIF 79 >ref|XP_012849406.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Erythranthe guttatus] gi|604315053|gb|EYU27759.1| hypothetical protein MIMGU_mgv1a012108mg [Erythranthe guttata] Length = 261 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 76 RAYHDGRPRGPLWRGKKLIGKEAIF 2 RAYHDGRPRGPLWRGKKLIGKEA+F Sbjct: 59 RAYHDGRPRGPLWRGKKLIGKEALF 83 >dbj|BAK03258.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 251 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 103 PQQFGWERVRAYHDGRPRGPLWRGKKLIGKEAIF 2 PQ FG R RA+HDGRPRGPLWR KKLIGKEA+F Sbjct: 41 PQPFGEWR-RAFHDGRPRGPLWRSKKLIGKEALF 73 >ref|XP_010043480.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Eucalyptus grandis] gi|629121006|gb|KCW85496.1| hypothetical protein EUGRSUZ_B02297 [Eucalyptus grandis] Length = 255 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 VR YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 52 VRRYHDGRPRGPLWRGKKLIGKEALF 77 >ref|XP_009350168.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g46870-like, partial [Pyrus x bretschneideri] Length = 212 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEAIF Sbjct: 8 LRLYHDGRPRGPLWRGKKLIGKEAIF 33 >ref|XP_006360926.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Solanum tuberosum] Length = 256 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 VR YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 53 VRWYHDGRPRGPLWRGKKLIGKEALF 78 >ref|XP_006858620.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Amborella trichopoda] gi|769794394|ref|XP_011628661.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Amborella trichopoda] gi|548862731|gb|ERN20087.1| hypothetical protein AMTR_s00066p00023060 [Amborella trichopoda] Length = 265 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 62 MRCYHDGRPRGPLWRGKKLIGKEALF 87 >gb|EPS64983.1| hypothetical protein M569_09798, partial [Genlisea aurea] Length = 203 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 76 RAYHDGRPRGPLWRGKKLIGKEAIF 2 R+YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 1 RSYHDGRPRGPLWRGKKLIGKEALF 25 >ref|XP_012066943.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] gi|802563533|ref|XP_012066944.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] Length = 269 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 66 LRQYHDGRPRGPLWRGKKLIGKEALF 91 >ref|XP_011032219.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Populus euphratica] gi|743865594|ref|XP_011032220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Populus euphratica] Length = 257 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 53 LRQYHDGRPRGPLWRGKKLIGKEALF 78 >ref|XP_010928561.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Elaeis guineensis] Length = 255 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -1 Query: 109 TNPQQFGWERVRAYHDGRPRGPLWRGKKLIGKEAIF 2 T+P + +E YHDGRPRGPLWRGKKL+GKEA+F Sbjct: 42 THPSEPIFELRHLYHDGRPRGPLWRGKKLLGKEALF 77 >ref|XP_009350170.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like isoform X2 [Pyrus x bretschneideri] Length = 133 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 50 LRLYHDGRPRGPLWRGKKLIGKEALF 75 >ref|XP_009350169.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like isoform X1 [Pyrus x bretschneideri] Length = 139 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 50 LRLYHDGRPRGPLWRGKKLIGKEALF 75 >ref|XP_008384905.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Malus domestica] Length = 256 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 52 LRLYHDGRPRGPLWRGKKLIGKEALF 77 >gb|KDP42187.1| hypothetical protein JCGZ_02917 [Jatropha curcas] Length = 257 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 54 LRQYHDGRPRGPLWRGKKLIGKEALF 79 >ref|XP_002517255.1| conserved hypothetical protein [Ricinus communis] gi|223543626|gb|EEF45155.1| conserved hypothetical protein [Ricinus communis] Length = 258 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 79 VRAYHDGRPRGPLWRGKKLIGKEAIF 2 +R YHDGRPRGPLWRGKKLIGKEA+F Sbjct: 55 LRQYHDGRPRGPLWRGKKLIGKEALF 80