BLASTX nr result
ID: Forsythia21_contig00040035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00040035 (206 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10794.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_011071025.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LI... 57 5e-06 >emb|CDP10794.1| unnamed protein product [Coffea canephora] Length = 331 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -1 Query: 131 ILIIYLCLPYTVQAHGFHSFKKLQLPSIGSEAYAFDSEGGGPY 3 +L+ + C P ++Q H HSFKKL LPSIGSEA AFD GGGPY Sbjct: 6 LLLFFFCFPCSLQVHASHSFKKLILPSIGSEACAFDPHGGGPY 48 >ref|XP_011071025.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum indicum] Length = 337 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MLSILIIYL-CLPYTVQAHGFHSFKKLQLPSIGSEAYAFDSEGGGPY 3 M+ I +++L C P+ A F SFKKLQLP++GSE+YAFDS GPY Sbjct: 1 MVPIFLLFLFCFPFNAGARCFRSFKKLQLPAVGSESYAFDSHNVGPY 47