BLASTX nr result
ID: Forsythia21_contig00039228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039228 (360 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containi... 59 2e-06 gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythra... 57 6e-06 >ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Erythranthe guttatus] Length = 760 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 261 MMASRAILRRRKILSDYLSIPVRSIQSFRTLGQ 359 MMASRAILRRRKI+SDYL++PVRS QSF+TLGQ Sbjct: 1 MMASRAILRRRKIVSDYLNVPVRSTQSFQTLGQ 33 >gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythranthe guttata] Length = 759 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 264 MASRAILRRRKILSDYLSIPVRSIQSFRTLGQ 359 MASRAILRRRKI+SDYL++PVRS QSF+TLGQ Sbjct: 1 MASRAILRRRKIVSDYLNVPVRSTQSFQTLGQ 32