BLASTX nr result
ID: Forsythia21_contig00038244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038244 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009348928.1| PREDICTED: uncharacterized protein LOC103940... 60 4e-07 ref|XP_009348925.1| PREDICTED: uncharacterized protein LOC103940... 60 4e-07 ref|XP_009348923.1| PREDICTED: uncharacterized protein LOC103940... 60 4e-07 ref|XP_009776655.1| PREDICTED: uncharacterized protein LOC104226... 60 6e-07 ref|XP_009361116.1| PREDICTED: uncharacterized protein LOC103951... 60 7e-07 ref|XP_009361112.1| PREDICTED: uncharacterized protein LOC103951... 60 7e-07 ref|XP_009361111.1| PREDICTED: uncharacterized protein LOC103951... 60 7e-07 ref|XP_008382288.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-06 ref|XP_008382268.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-06 ref|XP_008382262.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-06 ref|XP_008383834.1| PREDICTED: uncharacterized protein LOC103446... 57 6e-06 ref|XP_008383833.1| PREDICTED: uncharacterized protein LOC103446... 57 6e-06 ref|XP_008383832.1| PREDICTED: uncharacterized protein LOC103446... 57 6e-06 >ref|XP_009348928.1| PREDICTED: uncharacterized protein LOC103940522 isoform X5 [Pyrus x bretschneideri] Length = 287 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_009348925.1| PREDICTED: uncharacterized protein LOC103940522 isoform X2 [Pyrus x bretschneideri] Length = 354 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_009348923.1| PREDICTED: uncharacterized protein LOC103940522 isoform X1 [Pyrus x bretschneideri] Length = 356 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_009776655.1| PREDICTED: uncharacterized protein LOC104226377 isoform X1 [Nicotiana sylvestris] Length = 395 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = -2 Query: 205 ICSVFYSHLFCHKSRPYPGCT*RFPPITSIDFKMKPRTNEVPRM--SRGLQRDGPNWVLI 32 IC +FY+ F P +S+ KMKPRTN PR S+G+Q +GPNWV+I Sbjct: 18 ICCLFYTRAFFLLGILLLVLHSASPSYSSVTPKMKPRTNVGPRSQRSKGVQNEGPNWVII 77 Query: 31 AGSALLSTLS 2 AGSALLSTLS Sbjct: 78 AGSALLSTLS 87 >ref|XP_009361116.1| PREDICTED: uncharacterized protein LOC103951471 isoform X5 [Pyrus x bretschneideri] Length = 287 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_009361112.1| PREDICTED: uncharacterized protein LOC103951471 isoform X2 [Pyrus x bretschneideri] Length = 354 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_009361111.1| PREDICTED: uncharacterized protein LOC103951471 isoform X1 [Pyrus x bretschneideri] Length = 356 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_008382288.1| PREDICTED: uncharacterized protein LOC103445070 isoform X5 [Malus domestica] Length = 287 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q +GPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLS 52 >ref|XP_008382268.1| PREDICTED: uncharacterized protein LOC103445070 isoform X2 [Malus domestica] Length = 354 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q +GPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLS 52 >ref|XP_008382262.1| PREDICTED: uncharacterized protein LOC103445070 isoform X1 [Malus domestica] Length = 356 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T VPR+ R Q +GPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLS 52 >ref|XP_008383834.1| PREDICTED: uncharacterized protein LOC103446483 isoform X3 [Malus domestica] Length = 344 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T V R R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_008383833.1| PREDICTED: uncharacterized protein LOC103446483 isoform X2 [Malus domestica] Length = 354 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T V R R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLS 52 >ref|XP_008383832.1| PREDICTED: uncharacterized protein LOC103446483 isoform X1 [Malus domestica] Length = 356 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 136 FPPITSIDFKMKPRTNEVPRMSRG--LQRDGPNWVLIAGSALLSTLS 2 FPP T + FKMKP+T V R R Q DGPNWVLIAG ALLSTLS Sbjct: 7 FPP-TPLAFKMKPKTTAVSRAQRSKPFQGDGPNWVLIAGGALLSTLS 52