BLASTX nr result
ID: Forsythia21_contig00038170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038170 (299 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857645.1| PREDICTED: putative late blight resistance p... 57 6e-06 >ref|XP_012857645.1| PREDICTED: putative late blight resistance protein homolog R1A-3 [Erythranthe guttatus] Length = 1072 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/74 (37%), Positives = 49/74 (66%), Gaps = 7/74 (9%) Frame = -3 Query: 201 IDVKDQIRTIIEELKSLRPFLQDMEVQKHPELEGFL---IQTSDIAYEVLYILTSY---- 43 +DVK QI+T+ +EL L+D++V + E+EG + ++ D+AYE +++TS+ Sbjct: 262 VDVKGQIKTLKQELILSSSLLKDIKVPPYSEIEGSIEADVRARDVAYEAEFLITSFLVGD 321 Query: 42 APVWYLNLRLPQVM 1 AP+WY+ +RLP V+ Sbjct: 322 APLWYICIRLPHVI 335