BLASTX nr result
ID: Forsythia21_contig00037421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037421 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Med... 59 1e-06 >ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Medicago truncatula] Length = 733 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 156 TTPLSFGKLTPHRNCLYETVPWPVAPDTELEF 61 T PL FG+ TPHRNCL ETVPWPV PDT LEF Sbjct: 110 TPPLPFGRPTPHRNCLPETVPWPVGPDTRLEF 141